KEGG   Herpetosiphon aurantiacus: Haur_4949Help
Entry
Haur_4949         CDS       T00614                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Haur_4949
  Amino acid metabolism
   00300 Lysine biosynthesis
    Haur_4949
Enzymes [BR:hau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Haur_4949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6276438..6277535
Genome map
AA seq 365 aa AA seqDB search
MSIRTSLVDLTTRLVAIPSVSAEKRDLQPVIDLVVAELADYPAALLHHRDANGYPMLVVN
FNQELRSDLILNAHLDVVPARPEQWHAFEHDGKLYGRGTQDMKGSAAVYIEIIKEIAQLP
AEQRPNVSFQFVTDEEIGGANGTALLRDEGWQANLFIAGEPTNLNICHGAKGILWLAVEQ
PGVPAHGSRPWEGVNPIERLASGLGRLYEYYPTPAQEIWRTTVTPSIIKGGDAGNRIPAN
AQLNLDIRWTPEEGADAVIDNVKQAFATSSEPNPNVQILHRGTALNTPAEEPNLQRIVDA
QQSSLGRQAQLFREHFGSDARFYSDAGIPAVCWGPEGAGLHTDDEWVSIDGLVDYYQAVK
TLLGM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaatccgtacaagtttggttgatctgaccacgcgcttggtggcgattcccagtgtt
tccgccgaaaaacgcgatttgcagccagtgatcgatctggtggtggctgaattagccgat
tatccagcggcgttgttgcatcatcgcgatgctaatggctacccaatgttggtggtcaat
ttcaaccaagaactgcgcagcgatcttattttgaatgcccatttggatgttgtgccagcc
cgccctgagcaatggcacgccttcgagcatgatggcaaattgtatggtcgtggcacgcaa
gatatgaagggatcggcggcggtctacattgaaattattaaagaaattgcccaattgcct
gctgagcaacgccctaacgtaagctttcaatttgtgaccgatgaggaaattggcggagca
aatggcacagccttattgcgtgatgaaggctggcaggctaatttatttattgctggcgag
ccgaccaacctgaatatttgtcatggagccaagggcattttatggctggcagttgagcaa
ccaggcgtgccagcccatggttcgcggccttgggaaggcgtgaatccgattgagcgtttg
gcaagtggccttgggcgtttgtacgaatattatccaacgcctgcgcaagaaatttggcgc
actacggttacgccttcgattatcaaaggcggcgatgctggcaatcggattccagccaat
gcccaactgaatcttgatattcgctggacacccgaagaaggtgctgatgcggtgattgat
aacgtgaagcaagcctttgcaacgagcagcgaacccaatcccaatgtgcagattttgcat
cgtggcacggccctaaatacgccagccgaggagccaaacttacaacgcattgttgatgca
caacaatccagccttggtcgccaagcccaactcttccgcgagcattttggctccgatgcc
cgcttctacagcgatgccggaattccagcggtctgttgggggccagaaggtgcaggcttg
cataccgacgacgagtgggtcagcatcgatggcttggtcgattattatcaggcggtcaaa
accttgttgggtatgtag

DBGET integrated database retrieval system