KEGG   Hirschia baltica: Hbal_0047Help
Entry
Hbal_0047         CDS       T00945                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hba  Hirschia baltica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbal_0047
   01230 Biosynthesis of amino acids
    Hbal_0047
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbal_0047
  Energy metabolism
   00680 Methane metabolism
    Hbal_0047
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbal_0047
Enzymes [BR:hba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Hbal_0047
Exosome [BR:hba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Hbal_0047
  Exosomal proteins of melanoma cells
   Hbal_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
46519..47229
Genome map
AA seq 236 aa AA seqDB search
MAKLVLIRHGQSEWNLQNRFTGWWDVNLTDKGVAEAKKSGQMLAASGVAFDQAFVSVQKR
AIRTLWIALEEMERTWLPVTKDWHLNERHYGGLTGLDKAETAAKHGKDQVQIWRRSYDVP
PPPMEKGAEFDPANDVRYAGLDVPMTESLKLTLERVMPYFNAEIAPLLKADKNILIAAHG
NSLRAIVKDLFDVADDVITGVEIPTGNPLMIDLDADLKVKSAAYMDADRATEIPSF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccaaattggtattgatccgtcacggacaaagcgaatggaatttgcaaaaccgtttc
acaggttggtgggatgtaaacctaacagataaaggtgttgctgaagccaaaaaatctggt
caaatgcttgcagcttcaggtgtggcttttgatcaagcattcgtgtctgttcaaaaacgt
gccattcgtacgctgtggatcgctcttgaagaaatggaacgcacttggcttccggtcacc
aaagactggcacctgaatgaacgccattacggtggtttaaccggtttggacaaagctgaa
acagctgcaaagcacggtaaagatcaggttcaaatttggcgtcgttcatatgatgtgccg
ccacctcctatggaaaagggtgcggaattcgatccggcaaatgatgtacggtatgcaggc
ttagatgtgccgatgacggaaagtttgaaactcacacttgagcgcgttatgccatatttt
aacgctgaaattgcaccgcttcttaaagcagacaaaaatattctaattgctgcgcatgga
aattctttgcgtgccattgtgaaggatttgtttgatgtagcagatgatgtgatcactgga
gtggaaattccgactggtaacccacttatgatcgatttggatgctgacctaaaagttaaa
tccgctgcatatatggatgctgatcgtgcaacggaaattccttctttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system