KEGG   Hirschia baltica: Hbal_0072Help
Entry
Hbal_0072         CDS       T00945                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hba  Hirschia baltica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hbal_0072
Enzymes [BR:hba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hbal_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(70829..71551)
Genome map
AA seq 240 aa AA seqDB search
MTKLLTVLVTRAEPGATQTTNRLKQNGFLGEKLPAIKLTQTSIVFNQQNYKGALIFTSQN
GVQFAPRAPFRHAKQVFCVGDATAQAARQAGFKNIHSARGDANDLKQFISENWKPNNGPL
LHMGNSTPRGNIVQDLNDEGYDAEFLPVYQSKIHPDFEEKLRHRLQMDLKLDVILVHSPM
AAEFIDLALQDWSQLSSITLPKVVAISPDAGNPLKDLFNEKVICAAKPNEISLLEQLKVS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattgcttacggttttagtcacccgcgcggaaccaggtgctacacagacgaca
aaccgattgaaacaaaatggttttttgggtgaaaaactaccagcaataaagctcacccag
acttcaattgtatttaatcagcaaaactataaaggtgcgctgattttcactagccaaaat
ggcgttcaatttgcgcctcgcgctccatttcgacatgcaaaacaggtcttttgtgtcggc
gatgcaaccgcacaagcagcacgtcaagctggttttaaaaatattcactccgctcgcggt
gatgcaaatgatttaaaacaatttattagtgaaaactggaagcccaataatggaccattg
cttcatatgggtaattccaccccgcgcggaaatatcgttcaagatctgaatgatgagggg
tatgacgcagagttcttacctgtctaccaatctaaaattcatcctgattttgaagaaaaa
ttgcgacatcgcttacaaatggatttgaagcttgatgttattctggttcattcacccatg
gccgcagagtttatagatctcgcgcttcaagattggtcccaattatccagcattacactt
cctaaagtcgtagcaatttccccagatgcgggaaatccgctcaaagatctcttcaacgag
aaggtaatttgcgctgcaaaacctaatgaaattagtctgttagaacagcttaaagtctct
tga

DBGET integrated database retrieval system