KEGG   Hirschia baltica: Hbal_0165Help
Entry
Hbal_0165         CDS       T00945                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hba  Hirschia baltica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hba01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hba00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(177066..178229)
Genome map
AA seq 387 aa AA seqDB search
MDTITSTEGVDLLAKAERVVIKLGSALIVDEDGLADAARIQAISRDVIFLLGEGKQVVIV
SSGAVALGREALNLGSKKLKLEEKQAAAAAGQLRLMRTWEDAFLVHNIPVAQALLTIDDT
EIRRRWLNARATLDTLLEAGAVPIVNENDTIATDGIRFGDNDRLAARVAQMISADVLILL
SDIDGLYTADPRKDPKAKHIPFVRELTPDIMAMGGEPNAETGMGSGGMATKLEAARIAMT
AGCATVIALGRPESDEFDLPLSAINNGALATWFIPSFTRETARIQWLMGALQTSGTVYVD
EGAARAVKNGKSLLPAGILSVEGHFDRGDGIDVVGPGNVLISRGFSAYSSSDSMKLIGCN
SSQIESIVGYKGRPALIHTDDMLVLES
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggacaccataacaagcactgaaggcgtggacttattagccaaagccgaacgtgttgtc
ataaaacttggatcagcccttatcgtcgatgaggatggcttggccgatgcagctcgcatt
caagctatatctcgcgatgtcatatttctattaggagaaggcaaacaagttgtcattgtc
tcttcaggcgcagttgctctgggtcgggaagcattaaaccttggttctaaaaaattaaaa
ctagaagaaaaacaagccgctgcagccgcaggacaattacgcctgatgcggacatgggaa
gatgcattcctcgtccacaatattccggtcgcacaagcgctcctcacaattgatgataca
gaaatccgccgccgttggctaaatgcgcgcgcgacacttgatactctgctcgaagctggc
gctgtcccgatcgtcaatgaaaacgacaccattgcaacagacggtatccgctttggtgac
aatgaccgcctcgctgcacgtgttgctcaaatgatcagtgctgatgttcttattcttctc
tcagacattgatggtctctacacagcagatccacgcaaagatcccaaggccaaacacatc
ccattcgtcagagaattaacacccgatatcatggccatgggcggcgagcctaatgctgaa
acgggtatgggttctggcggcatggccacaaaactagaagccgcccgtatcgccatgaca
gcagggtgtgcaacagttatcgctcttggacgaccagaaagcgacgagtttgacctccca
ctcagcgccatcaataatggtgccttggcgacatggtttattccaagtttcacacgggaa
actgcgcgtattcaatggctcatgggtgccttgcagacatccggcacggtttatgtcgat
gaaggtgcagcacgcgccgtcaaaaatggaaaaagcctccttcctgcgggtatactctct
gttgaaggccattttgatcgcggtgacggcattgatgtcgtcgggcccggcaacgtatta
atttcgcgtggttttagcgcctattcctcaagcgactccatgaaactcattggatgcaat
tcaagccagattgaaagcattgttggatataaaggtcgaccagccctaatccacaccgat
gatatgctcgttcttgaatcctaa

DBGET integrated database retrieval system