KEGG   Hirschia baltica: Hbal_0302Help
Entry
Hbal_0302         CDS       T00945                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hba  Hirschia baltica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbal_0302
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hbal_0302
   00650 Butanoate metabolism
    Hbal_0302
  Energy metabolism
   00190 Oxidative phosphorylation
    Hbal_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
331646..332044
Genome map
AA seq 132 aa AA seqDB search
MSNSMRTPLGKVRGLGSARDGAGHFIGQRVSAVALVFLVPWFLISLLGATRGDNTLERFA
NAEAWLSQPLNAILVLLAVCGTIYHMRLGLQVVIEDYISGHMPRIVLLMLNTFLSFALIA
ATVFSVFKVAVA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactctatgcgcacaccacttggtaaagttcgcggtcttgggtctgcacgtgat
ggtgcaggtcactttattgggcaacgcgtttcagccgtcgctctcgtattcttagtacct
tggttcctgatttctcttttgggcgcaacgcgcggtgataatacactcgagcgttttgcg
aacgcggaagcttggctttctcagccgttgaatgccattttggtgcttctagccgtttgc
ggcacaatttatcacatgcgtcttggattgcaggttgtgattgaggattatatctcaggt
cacatgccccgcatcgttttgttgatgctaaacacatttctcagcttcgcgttgatcgct
gcgactgtgttctccgtatttaaagttgcagtagcataa

DBGET integrated database retrieval system