KEGG   Hirschia baltica: Hbal_0305Help
Entry
Hbal_0305         CDS       T00945                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hba  Hirschia baltica
Pathway
hba00020  Citrate cycle (TCA cycle)
hba00190  Oxidative phosphorylation
hba00650  Butanoate metabolism
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01120  Microbial metabolism in diverse environments
hba01130  Biosynthesis of antibiotics
hba01200  Carbon metabolism
Module
hba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hba_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hbal_0305
   00650 Butanoate metabolism
    Hbal_0305
  Energy metabolism
   00190 Oxidative phosphorylation
    Hbal_0305
Enzymes [BR:hba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Hbal_0305
    1.3.5.4  fumarate reductase (quinol)
     Hbal_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer4_9 Fer4_18 Fer2 Fer4
Motif
Other DBs
NCBI-ProteinID: ACT58007
JGI: Hbal_0305
UniProt: C6XLV1
Position
335025..335810
Genome map
AA seq 261 aa AA seqDB search
MVQLTLPQNSKVKNGKTWSGPKSEGASSLKTFRIYRFDPDTGENPRWDTYEVDTKLFGPM
VLDALIYIKNEVDPTLAFRRSCREGVCGSCAMNIGGRNTIACTKGHDEFKGKITISPLPH
QPVIKDLVPDLSQFYAQHAYVAPYLQTTTPEPQREWKQTPQEREKLDGLYECIMCASCST
SCPSYWWNGDKYLGPAALLQAYRWLIDSRDEETGSRLDDLEDPFKLYRCHTIMNCAQVCP
KGLNPAEAIASIKTMMVERRV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttcagctaacgcttccgcagaactctaaagttaaaaatggtaagacttggtctggc
cctaaaagtgaaggtgcttcctcacttaagacctttcggatttaccgtttcgatccagac
actggtgagaacccgcgttgggatacttatgaagtagacaccaaattatttggaccaatg
gttcttgatgcattgatctatatcaagaatgaagttgacccgactttggcattccgtcgc
tcatgtcgtgagggtgtatgtggatcatgtgccatgaatattggtggtcgcaacacgatt
gcctgtacgaaaggccatgatgaatttaaaggcaaaatcacaatttcgcctttgcctcac
cagccagttattaaagaccttgtgccagatctttctcagttttacgcacagcacgcatat
gttgcgccatatttgcaaacaacaacaccagagcctcagcgtgagtggaaacaaacacca
caagagcgcgaaaagcttgatggtctatatgaatgtatcatgtgtgcatcctgttcgacg
tcttgtccgtcatattggtggaatggtgacaaatatcttgggcctgcggctttgcttcaa
gcttaccgttggttgattgatagccgtgatgaagaaacaggttcacgtcttgatgatctt
gaggacccgttcaagctttaccgttgtcacacgattatgaattgtgcgcaggtttgcccg
aaaggcttaaacccagccgaagcaatcgcaagcatcaaaacaatgatggtcgagcgtcgc
gtttaa

DBGET integrated database retrieval system