KEGG   Hirschia baltica: Hbal_0305Help
Entry
Hbal_0305         CDS       T00945                                 

Gene name
sdhB
Definition
succinate dehydrogenase iron-sulfur subunit (EC:1.3.5.1)
Orthology
K00240  
succinate dehydrogenase iron-sulfur subunit [EC:1.3.99.1]
Organism
hba  Hirschia baltica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:hba01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hba00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hba00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hba00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
335025..335810
Genome map
AA seq 261 aa AA seqDB search
MVQLTLPQNSKVKNGKTWSGPKSEGASSLKTFRIYRFDPDTGENPRWDTYEVDTKLFGPM
VLDALIYIKNEVDPTLAFRRSCREGVCGSCAMNIGGRNTIACTKGHDEFKGKITISPLPH
QPVIKDLVPDLSQFYAQHAYVAPYLQTTTPEPQREWKQTPQEREKLDGLYECIMCASCST
SCPSYWWNGDKYLGPAALLQAYRWLIDSRDEETGSRLDDLEDPFKLYRCHTIMNCAQVCP
KGLNPAEAIASIKTMMVERRV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttcagctaacgcttccgcagaactctaaagttaaaaatggtaagacttggtctggc
cctaaaagtgaaggtgcttcctcacttaagacctttcggatttaccgtttcgatccagac
actggtgagaacccgcgttgggatacttatgaagtagacaccaaattatttggaccaatg
gttcttgatgcattgatctatatcaagaatgaagttgacccgactttggcattccgtcgc
tcatgtcgtgagggtgtatgtggatcatgtgccatgaatattggtggtcgcaacacgatt
gcctgtacgaaaggccatgatgaatttaaaggcaaaatcacaatttcgcctttgcctcac
cagccagttattaaagaccttgtgccagatctttctcagttttacgcacagcacgcatat
gttgcgccatatttgcaaacaacaacaccagagcctcagcgtgagtggaaacaaacacca
caagagcgcgaaaagcttgatggtctatatgaatgtatcatgtgtgcatcctgttcgacg
tcttgtccgtcatattggtggaatggtgacaaatatcttgggcctgcggctttgcttcaa
gcttaccgttggttgattgatagccgtgatgaagaaacaggttcacgtcttgatgatctt
gaggacccgttcaagctttaccgttgtcacacgattatgaattgtgcgcaggtttgcccg
aaaggcttaaacccagccgaagcaatcgcaagcatcaaaacaatgatggtcgagcgtcgc
gtttaa

DBGET integrated database retrieval system