KEGG   Hirschia baltica: Hbal_0373Help
Entry
Hbal_0373         CDS       T00945                                 

Definition
homocysteine S-methyltransferase
Orthology
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
hba  Hirschia baltica
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hba01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hba00270]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:hba00450]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hba00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
400433..401485
Genome map
AA seq 350 aa AA seqDB search
MNREQRLEKITKIANERVLILDGAMGTELQTFKLTEEDFRGAQFKDVDRFLKGNNDLLNL
TKPDVVKEVHRRYFNAGADIAETNTFSATTIAQADYALESLAAEIAREGAKIAREVADEF
ETEDAPKAVWSAIGPTNKTLSLSPDVNDPGFREVTFEHVAKAYQEQIAAMAEFSDVFLIE
TVFDTLNAKAAIKAVKDWEFESGESRPIVLSGTITDASGRTLSGQTTEAFWYSVRHAKPW
AIGLNCALGADLMRQYVVALSRVADTRVLAYPNAGLPNEFGEYDVTPDEQAVHLKAWAQD
GIVNVLGGCCGTTPAHIEAIAKAVKSSAPRKIPSIDPAMRLSGLEPFVLA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaacaaagattagaaaaaatcaccaaaattgcgaatgagcgtgtgcttatt
ctcgatggagcaatgggaacagagcttcagacatttaagctgactgaagaagattttcgt
ggtgcgcagtttaaagatgtggatcgcttcctcaaaggaaataatgatctactgaattta
acaaaacctgacgtggtgaaagaagtgcatcgccgttattttaatgctggtgcggatata
gcggaaaccaacacattttcagctaccacaattgcgcaagctgattacgcattggaatcc
cttgctgcagaaattgcgcgtgaaggtgcgaaaattgcgcgtgaagttgcagatgaattt
gaaactgaagatgcgcccaaagctgtctggtctgcgattgggccgacaaacaaaaccttg
tcactttctcccgatgtgaatgacccaggatttcgtgaagtcacgtttgaacatgttgct
aaagcgtatcaggaacagatcgccgcaatggctgagttttcagatgtgtttttgattgaa
acggtgtttgataccctcaatgcaaaagctgctatcaaagcggtgaaagattgggaattt
gagtctggtgagagccgtccgattgtgttgtcaggcacgatcacagatgcctcaggacga
acattatcgggacagacaacggaagcattctggtattctgtgcgtcatgcaaaaccgtgg
gcgattggattaaattgtgccttgggtgctgatctcatgcgtcagtatgtggtcgcgctg
tctagggtcgctgatacacgcgtgttggcttatccaaatgctggtttacccaatgaattc
ggggagtatgatgtgacaccggacgagcaagctgtacacctaaaagcttgggcgcaagat
ggtatcgtcaatgttcttggcggatgttgcgggacaacgcctgcacacattgaagcaatt
gcaaaagccgtaaaatcgagcgcgccgcgaaaaataccaagtattgatccggctatgcgt
ttgtctggacttgagccgtttgttttggcctag

DBGET integrated database retrieval system