KEGG   Hirschia baltica: Hbal_0373Help
Entry
Hbal_0373         CDS       T00945                                 

Definition
homocysteine S-methyltransferase
Orthology
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
hba  Hirschia baltica
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbal_0373
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Hbal_0373
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hbal_0373
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Hbal_0373
Enzymes [BR:hba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Hbal_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
400433..401485
Genome map
AA seq 350 aa AA seqDB search
MNREQRLEKITKIANERVLILDGAMGTELQTFKLTEEDFRGAQFKDVDRFLKGNNDLLNL
TKPDVVKEVHRRYFNAGADIAETNTFSATTIAQADYALESLAAEIAREGAKIAREVADEF
ETEDAPKAVWSAIGPTNKTLSLSPDVNDPGFREVTFEHVAKAYQEQIAAMAEFSDVFLIE
TVFDTLNAKAAIKAVKDWEFESGESRPIVLSGTITDASGRTLSGQTTEAFWYSVRHAKPW
AIGLNCALGADLMRQYVVALSRVADTRVLAYPNAGLPNEFGEYDVTPDEQAVHLKAWAQD
GIVNVLGGCCGTTPAHIEAIAKAVKSSAPRKIPSIDPAMRLSGLEPFVLA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaacaaagattagaaaaaatcaccaaaattgcgaatgagcgtgtgcttatt
ctcgatggagcaatgggaacagagcttcagacatttaagctgactgaagaagattttcgt
ggtgcgcagtttaaagatgtggatcgcttcctcaaaggaaataatgatctactgaattta
acaaaacctgacgtggtgaaagaagtgcatcgccgttattttaatgctggtgcggatata
gcggaaaccaacacattttcagctaccacaattgcgcaagctgattacgcattggaatcc
cttgctgcagaaattgcgcgtgaaggtgcgaaaattgcgcgtgaagttgcagatgaattt
gaaactgaagatgcgcccaaagctgtctggtctgcgattgggccgacaaacaaaaccttg
tcactttctcccgatgtgaatgacccaggatttcgtgaagtcacgtttgaacatgttgct
aaagcgtatcaggaacagatcgccgcaatggctgagttttcagatgtgtttttgattgaa
acggtgtttgataccctcaatgcaaaagctgctatcaaagcggtgaaagattgggaattt
gagtctggtgagagccgtccgattgtgttgtcaggcacgatcacagatgcctcaggacga
acattatcgggacagacaacggaagcattctggtattctgtgcgtcatgcaaaaccgtgg
gcgattggattaaattgtgccttgggtgctgatctcatgcgtcagtatgtggtcgcgctg
tctagggtcgctgatacacgcgtgttggcttatccaaatgctggtttacccaatgaattc
ggggagtatgatgtgacaccggacgagcaagctgtacacctaaaagcttgggcgcaagat
ggtatcgtcaatgttcttggcggatgttgcgggacaacgcctgcacacattgaagcaatt
gcaaaagccgtaaaatcgagcgcgccgcgaaaaataccaagtattgatccggctatgcgt
ttgtctggacttgagccgtttgttttggcctag

DBGET integrated database retrieval system