KEGG   Hirschia baltica: Hbal_0373Help
Entry
Hbal_0373         CDS       T00945                                 

Definition
(GenBank) homocysteine S-methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
hba  Hirschia baltica
Pathway
hba00270  Cysteine and methionine metabolism
hba00450  Selenocompound metabolism
hba00670  One carbon pool by folate
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Hbal_0373
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hbal_0373
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Hbal_0373
Enzymes [BR:hba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Hbal_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: ACT58075
JGI: Hbal_0373
UniProt: C6XMD2
Position
400433..401485
Genome map
AA seq 350 aa AA seqDB search
MNREQRLEKITKIANERVLILDGAMGTELQTFKLTEEDFRGAQFKDVDRFLKGNNDLLNL
TKPDVVKEVHRRYFNAGADIAETNTFSATTIAQADYALESLAAEIAREGAKIAREVADEF
ETEDAPKAVWSAIGPTNKTLSLSPDVNDPGFREVTFEHVAKAYQEQIAAMAEFSDVFLIE
TVFDTLNAKAAIKAVKDWEFESGESRPIVLSGTITDASGRTLSGQTTEAFWYSVRHAKPW
AIGLNCALGADLMRQYVVALSRVADTRVLAYPNAGLPNEFGEYDVTPDEQAVHLKAWAQD
GIVNVLGGCCGTTPAHIEAIAKAVKSSAPRKIPSIDPAMRLSGLEPFVLA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaacaaagattagaaaaaatcaccaaaattgcgaatgagcgtgtgcttatt
ctcgatggagcaatgggaacagagcttcagacatttaagctgactgaagaagattttcgt
ggtgcgcagtttaaagatgtggatcgcttcctcaaaggaaataatgatctactgaattta
acaaaacctgacgtggtgaaagaagtgcatcgccgttattttaatgctggtgcggatata
gcggaaaccaacacattttcagctaccacaattgcgcaagctgattacgcattggaatcc
cttgctgcagaaattgcgcgtgaaggtgcgaaaattgcgcgtgaagttgcagatgaattt
gaaactgaagatgcgcccaaagctgtctggtctgcgattgggccgacaaacaaaaccttg
tcactttctcccgatgtgaatgacccaggatttcgtgaagtcacgtttgaacatgttgct
aaagcgtatcaggaacagatcgccgcaatggctgagttttcagatgtgtttttgattgaa
acggtgtttgataccctcaatgcaaaagctgctatcaaagcggtgaaagattgggaattt
gagtctggtgagagccgtccgattgtgttgtcaggcacgatcacagatgcctcaggacga
acattatcgggacagacaacggaagcattctggtattctgtgcgtcatgcaaaaccgtgg
gcgattggattaaattgtgccttgggtgctgatctcatgcgtcagtatgtggtcgcgctg
tctagggtcgctgatacacgcgtgttggcttatccaaatgctggtttacccaatgaattc
ggggagtatgatgtgacaccggacgagcaagctgtacacctaaaagcttgggcgcaagat
ggtatcgtcaatgttcttggcggatgttgcgggacaacgcctgcacacattgaagcaatt
gcaaaagccgtaaaatcgagcgcgccgcgaaaaataccaagtattgatccggctatgcgt
ttgtctggacttgagccgtttgttttggcctag

DBGET integrated database retrieval system