KEGG   Hirschia baltica: Hbal_0388Help
Entry
Hbal_0388         CDS       T00945                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hba  Hirschia baltica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hbal_0388
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hbal_0388
Enzymes [BR:hba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Hbal_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
414426..415877
Genome map
AA seq 483 aa AA seqDB search
MKLSQIFDNAPDWEFTGLTCDSRKVAPGFVFAALLGTVSDGRDFIQAAIDNGAIAVLTDE
RDGEWEIPAIKVAEPRLAFAKAAAAFYHKQPEVMVAVTGTNGKSSTVDFLRQIWTELGHV
SASVGTLGAVGPSGAVELGHTTPDPVAVQSTLAILANEGVTHCAMEASSHGLAQYRMHGV
QLAAGGFLNLSQDHLDYHKDFEDYFAAKMKLFSELLPEGAPAIINADSDMKDKALAIATA
ANLKPFTVGWRGDHLWIDEISPRNTGQKLQLQWETPEGDKETIVNLPLIGEFQALNALAA
AGIALSLGADPMAVFAAMEKLKGVKGRLELVAETQNGAGIFVDFAHTPDGLDTLLRAARP
HAAGRVICVFGCGGDRDAGKRPIMGEIAAKYADEVIVTDDNPRSEDPASIRAAIMAGAPN
ATEIDGREAAIKEGISRLKKGDVLMIAGKGHETGQIIKGETFPFSDHEAALTALAEIEGG
AEK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagccaaatttttgacaatgcaccagattgggaattcacaggtctgacgtgt
gatagccgaaaagtggcgccaggctttgtgttcgcagcgttgctaggcacagtgtctgac
gggcgcgatttcattcaagcagctattgataatggtgcgattgctgtcttgacagatgaa
cgtgatggggaatgggaaattcctgctattaaagtcgcggagccacgtttggcgtttgcg
aaagctgccgccgctttttatcataaacagccagaagtcatggttgctgtgacggggaca
aatggcaaatcgtctactgttgatttcttgcgtcaaatatggacagagcttgggcatgtt
tcagcatctgttggaacgttgggagccgtcggcccatccggtgcggttgagcttggtcac
acgacaccagaccctgtggctgtgcagtctactctagcgattttggcgaatgaaggtgtc
acccattgtgcaatggaagcttcatctcatgggttggcgcaatatcgtatgcatggcgtc
caactggctgcgggtggttttttgaatctttcacaagatcatttggattatcacaaagat
tttgaagactattttgctgctaagatgaagctgttttccgaacttcttcctgaaggcgca
ccagcaataatcaatgctgacagcgatatgaaagacaaggctttggcgattgcgacagcg
gcaaatttaaagccattcactgttggttggcgcggtgatcatctttggattgatgaaatt
tcacctcgcaacacaggacagaaactgcaattgcaatgggaaacgcctgagggtgataaa
gaaacaatcgtaaatcttccattgatcggtgaatttcaggcgctcaatgctttggctgcg
gctggtattgcgctgtctcttggtgctgatccaatggcggtatttgccgctatggaaaag
ctaaagggtgtgaaggggcggcttgaattagttgctgaaactcaaaacggagcaggaatt
ttcgtagatttcgctcacacgcctgacggactggatacattgttacgtgcggcgcgtcct
cacgcagctggacgcgtgatttgtgtgtttggatgcggcggtgaccgtgacgcaggtaaa
cgtccaatcatgggtgaaatagcagcaaaatatgctgatgaagttatcgtcacagatgat
aatccacgctcggaagatccagcatccattcgcgcggcaataatggcaggcgctcccaat
gcaacggaaattgatggccgtgaagctgcgatcaaagagggtatttcccgtttgaaaaag
ggtgatgtgctcatgattgccggtaaaggtcatgagacaggtcagataatcaaaggcgaa
acattcccattctctgatcatgaagctgcgttgacagctttagctgagatagagggaggc
gctgaaaagtga

DBGET integrated database retrieval system