KEGG   Hirschia baltica: Hbal_0856Help
Entry
Hbal_0856         CDS       T00945                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
hba  Hirschia baltica
Pathway
hba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hbal_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YtxH Apolipoprotein Cytochrom_C ApoLp-III Phasin Collagen_mid Mitofilin DUF677 Cytochrome_CBB3 yrzK EspB Phasin_2 KfrA_N WXG100
Motif
Other DBs
NCBI-ProteinID: ACT58550
JGI: Hbal_0856
UniProt: C6XQ33
Position
complement(910218..911117)
Genome map
AA seq 299 aa AA seqDB search
MSDLGLNKIMAAAFSTGLAILGLNAASDAFFEHDGPEQPGYLVEVAATDAGHGDDEPKWI
PPTDYGVLLAEADIAKGQKKVAACASCHNFEPNGPNGTGPGLYDVVMRDKASHGGFGYSD
ALISLGGQWDYASLDGFLKNPKKYASGTAMNYAGLSKETDRMNVIAYLHSLSASPAPLPA
PLPPEAFIEPTSGEEAHGDVVDAAHETAEDAGHAVDAAHEEVENVSADAEAGVDALTDAA
EGAQSDVADAVEEATETASDTASSIVDDVTEAVESATDEVEEAAEEVGEEVDTEHGPHN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttgggcttaaacaaaattatggctgcggcattctcaacgggtcttgcgatc
cttggtctaaacgcggcaagtgatgcttttttcgagcatgacggaccagaacaaccagga
tacctcgttgaggtggcagcgacagacgctggtcacggcgatgacgaaccgaaatggatt
ccaccaacagattatggtgtccttctcgcggaagctgacattgctaaaggtcagaaaaaa
gtagctgcttgtgcaagctgtcacaatttcgaaccgaacggaccaaatggcactggaccg
ggcctatatgacgttgttatgcgtgataaagcctctcacggtgggtttggatattcagac
gccttgattagcctcggcggtcaatgggattacgcttctctagatggcttcctgaaaaac
ccgaaaaaatacgcttctggtacagctatgaattatgctggtctttctaaggaaaccgac
cgcatgaacgtcattgcatacctgcactcactttccgcttcgcctgctccgcttcctgct
ccattaccacctgaagcgttcatcgagccaacaagtggtgaagaagcacatggcgatgtt
gtcgacgctgcccacgaaacagccgaagacgctggacacgctgtagatgctgctcacgaa
gaagtagagaatgtaagcgctgatgctgaagctggggtcgatgcactcacagatgctgct
gaaggtgctcaatcggatgtcgcagatgccgtcgaagaagcaacagagacagcttctgac
acagcaagctcaattgtagacgatgtcactgaagctgtagagtcagctactgatgaagtt
gaagaagctgctgaagaggttggcgaggaagttgatacagaacacggtcctcacaactaa

DBGET integrated database retrieval system