KEGG   Hirschia baltica: Hbal_0931Help
Entry
Hbal_0931         CDS       T00945                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hba  Hirschia baltica
Pathway
hba00071  Fatty acid degradation
hba00280  Valine, leucine and isoleucine degradation
hba00281  Geraniol degradation
hba00310  Lysine degradation
hba00362  Benzoate degradation
hba00380  Tryptophan metabolism
hba00410  beta-Alanine metabolism
hba00640  Propanoate metabolism
hba00650  Butanoate metabolism
hba00903  Limonene and pinene degradation
hba00930  Caprolactam degradation
hba01040  Biosynthesis of unsaturated fatty acids
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01120  Microbial metabolism in diverse environments
hba01130  Biosynthesis of antibiotics
hba01200  Carbon metabolism
hba01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hbal_0931
   00650 Butanoate metabolism
    Hbal_0931
  Lipid metabolism
   00071 Fatty acid degradation
    Hbal_0931
   01040 Biosynthesis of unsaturated fatty acids
    Hbal_0931
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hbal_0931
   00310 Lysine degradation
    Hbal_0931
   00380 Tryptophan metabolism
    Hbal_0931
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hbal_0931
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Hbal_0931
   00281 Geraniol degradation
    Hbal_0931
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hbal_0931
   00930 Caprolactam degradation
    Hbal_0931
Enzymes [BR:hba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Hbal_0931
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Hbal_0931
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Hbal_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH DUF2680 NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACT58625
JGI: Hbal_0931
UniProt: C6XQL9
Position
994935..997142
Genome map
AA seq 735 aa AA seqDB search
MNLTQFSFEVGDNGVALAKFDAPERSMNTLTRAANEDIAAIVKEVTENDAIKGLVFTSGK
ESGFCAGADLGEMTGLLALASKAETPEEKAEVFNMAFGINKLFREMETCGKPVAIAINGL
AMGGGLELALACHYRIIADDQPKLRIALPEGKIGLLPGGGGTQRLPRLMGIQAAAPYLLQ
GKTMKAAEAVSMGVCHASAPTAELVEKATEWVLANPKAVAPWDQPKFKVPGGIPNQHPMA
TQVLMMGNAMIVKETHGNYPAQKNILSCVYEGLQLSMDLAIKVESRYFAKTVATPEAQGM
VRTLFQSLQDLSKGASRPEGVPKYEINKVGVVGAGLMGAGIAYVQAAAGIPTILVDVSQE
SADRGKDYSKRIVDKAVSRGKMTQEKADALLALITPTTDYDQLKGSDLIIEAVYENPELK
AKITADCEAQIADTAVMGSNTSTLPITGLAEASSRPDNFIGIHFFSPVERMGLVEIIMGE
KTSKETLAKAIDYVLKIKKTPVAVNDFRGFYTSRCFSTYTHEGITMLSEGIAPAIIENVG
RQSGMPMGPLEVSDSVGLDTGLKIGRQMAAAEGVDYNADPLGALTAWIVEEKDRVGRKAG
KGYYDYDEKGKPSQIWKGLSEKIEVKTTEVSLEERQELINRLLVRQSVEVARCFEEGVIT
DARDGDVGSILAWGFAPYTGGAVSYIDLKWGVAAFVAEADRLADAYGERFRPGAMLREMA
TKGQTFYERFPPAGK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaacacaattctccttcgaggtaggtgataacggcgttgcgttggcaaagttt
gatgcacctgagcgttctatgaacacactgacgcgagcggcaaatgaagatattgctgcg
attgtcaaagaagtcacagagaacgacgcgattaaaggtcttgtttttacatcaggaaaa
gagtccggcttctgtgcgggtgctgaccttggtgagatgacaggtcttttggcattagca
agtaaagcagaaacaccagaagaaaaagccgaagttttcaacatggcttttggcattaac
aagcttttccgcgaaatggaaacatgcggtaagccggttgctattgcgattaatggtttg
gcgatgggcggcggtttagagctggcacttgcttgtcactaccgtatcattgctgatgat
caaccaaagctgcgcattgcgcttcctgaaggcaaaatcggtttgctaccaggtggtggt
ggtacacagcgtcttccgcgtttgatgggaattcaggctgctgcaccttaccttcttcaa
gggaagacaatgaaagcggctgaagctgtttctatgggcgtgtgtcacgcatctgcgcca
actgctgagcttgtcgaaaaagcgactgagtgggttcttgcaaacccgaaagctgttgcg
ccttgggatcaacctaaatttaaagtgccgggcggaattccaaaccagcacccaatggcg
acacaagtcttgatgatgggtaatgccatgatcgttaaagagactcacggtaactatcca
gcacagaaaaacattctttcatgtgtgtatgaaggtcttcaattatcgatggatctggcg
atcaaagttgagagccgttacttcgctaaaacagtggcgacaccagaagcccaaggcatg
gtgcggacattgttccaatccttgcaagacctatccaaaggtgcatcacgtccagaaggc
gttccaaaatacgaaatcaacaaagttggtgtcgtgggtgcggggcttatgggagctggt
attgcttatgttcaagcagctgccggtattccaactattcttgtggatgtgtctcaagag
tcagctgatcgcggtaaagattattcaaaacgtatcgtcgataaagccgttagtcgcggt
aagatgacacaagaaaaagcggatgctcttcttgcgttgattactcccacaacagactat
gaccagcttaaaggatctgacctgatcattgaagctgtgtatgaaaacccagagctaaaa
gctaagattacggctgattgtgaagcacaaattgctgatacagccgtgatgggatcaaac
acatcaacattgccgattacaggtcttgcggaagcgtcatcgcgtcctgacaatttcatt
ggtatccacttcttctcacctgttgagagaatggggcttgttgaaattattatgggtgag
aaaacgtctaaagagactttggctaaagcaatcgactatgtgcttaagatcaagaagact
cctgttgccgttaatgacttccgtggtttctatacatcgcgttgtttcagcacatatacg
catgaaggcatcacaatgctgagtgaaggtattgcaccagctatcattgagaatgttgga
cgccaatctggtatgcctatgggcccacttgaagtgtctgatagtgttggacttgataca
gggcttaagattggacgtcagatggcagctgcagagggtgttgattacaatgccgatccg
ctaggtgctttgacagcttggattgttgaagaaaaagaccgtgtcggccgcaaagccggt
aaaggttattatgactatgatgaaaaaggtaagccttcacaaatttggaaaggcttgtct
gagaaaatcgaagtcaaaacaacagaagtgtctcttgaagagcgccaagaacttattaat
cgtcttctggttcgccaaagcgttgaagttgcacgttgttttgaagagggtgttatcact
gatgcgcgtgatggtgatgtcggatctatccttgcgtggggctttgcgccttacacaggt
ggagcggtttcatacattgaccttaaatggggcgtagctgcgtttgtggctgaagcagac
cgtttagcagatgcatatggtgagcgtttccgtcctggagccatgctacgtgaaatggcg
acaaagggacaaaccttctacgaacgttttcctcccgctggtaagtaa

DBGET integrated database retrieval system