KEGG   Hirschia baltica: Hbal_1031Help
Entry
Hbal_1031         CDS       T00945                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hba  Hirschia baltica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbal_1031
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbal_1031
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hbal_1031
Enzymes [BR:hba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hbal_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1105249..1106637
Genome map
AA seq 462 aa AA seqDB search
MRYISTRGGAEPVDFVTASLAGLAPDGGLYIPQEFPTIDRPAQDEPYHVTAARILKAFAG
ESIEYDVIEDLAAKAYGAFSHQSVAPLTQIGQGKWMMELHHGPTLAFKDVAMRFIAQLYD
YALGQRGERMTIVCATSGDTGGAAAAAFAGAENVDVMILHPHNRISPVQRVFMSATGASN
IHNFALEGDFDQCQAIVKELFADEQTKRRLNLSGVNSINWTRIAAQSVYFATAQAQLGAD
AKIRFVVPSGNFGDALAGYVAARSGLLNGFECHVAVNANDAMARLLDGQELKKGETTPTK
SPAMDIQVPSNFERLLFEATGRDGAAIKAAYDQLAKDGAAPLPEKAIGPLGCMGFTASAV
SDAETFVEMQKTLDETGWQVCPHTAVGLYALRHNPSKDVVDVVLSTAHAAKFPETVLEAI
GQDAPLPARAHEFTSRPEVFETGPMDINHVKERMVALSRVTA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatttctactcgaggcggagcagagcccgttgattttgtaacagccagtctt
gcaggacttgcacctgatggtggtttgtacattcctcaggagtttccaacgattgatcgt
ccggcgcaggatgagccttaccatgtaactgctgcacgcattctaaaagcgtttgcaggt
gagtccattgaatatgatgtgattgaagatcttgctgccaaagcttatggtgcattctca
caccagtctgttgcgcctttgacgcaaattggacaaggcaaatggatgatggaattgcac
catggtccgacgcttgcgtttaaagatgtggcgatgcgctttattgcgcagctttatgat
tatgcccttggtcagcgcggtgagcgtatgacgattgtgtgtgcgacatctggcgataca
ggcggagcggcagcggctgcatttgctggagctgaaaatgtagatgttatgattttgcat
ccgcacaatcgtatctctcccgtgcagcgtgttttcatgtcggcaacgggtgcgtctaat
attcataattttgcgcttgagggtgattttgatcagtgtcaggcgatcgtcaaagaattg
tttgctgatgagcaaactaaacgccgtttgaatttatcgggcgtcaactccatcaattgg
acacgtatagcggcgcaatctgtttattttgcaaccgcgcaagctcaactaggcgctgat
gcaaaaattcgtttcgttgtgccatcaggtaattttggggatgcgttagctgggtatgtt
gctgcgcgctctggcctgttgaacggatttgaatgtcacgtggccgtgaatgccaatgat
gcaatggcccgtttgctggatggtcaggaattgaaaaaaggcgagacaacaccaacgaaa
agtcctgctatggatattcaggtgccatctaactttgagcgtctattatttgaagccact
ggtcgagacggtgctgcgattaaagcagcttatgatcaacttgctaaagatggcgctgcg
ccattgccagaaaaagcaattggtccgcttggctgcatgggctttacggcaagtgcagtt
tctgatgctgagacatttgtagaaatgcaaaagacgctggatgaaactggctggcaagtg
tgtccacatacagctgttggattgtacgctttgcggcataatccatcaaaagatgttgtc
gatgttgtgctttcaactgcacatgccgcgaaatttcctgagacagttttggaagcaatt
ggacaagatgcaccgctgcctgcacgtgcgcatgaatttacatctcgcccagaagttttt
gagacagggccaatggatatcaatcatgttaaagagcgtatggttgcactatcccgggtg
actgcttga

DBGET integrated database retrieval system