KEGG   Hirschia baltica: Hbal_1394Help
Entry
Hbal_1394         CDS       T00945                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hba  Hirschia baltica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hbal_1394
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Hbal_1394
Enzymes [BR:hba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Hbal_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1458476..1459552
Genome map
AA seq 358 aa AA seqDB search
MSAPKACILSVSGPELLDEEAIFLAQHNPWGIILMGRSVKSRKQVRALVDAIWSALGRPC
LVFIDQEGGRVRRMRPPEWPEFPAGEAYARLYQKSPELGKEAAWLGHRLMAAELQPLGIF
ADCAPILDLLHHDAHDIVGDRAFGSSPQQVAEIGSAAIKGLMDGGVASVIKHIPGHGRAK
QDSHEALPVVDASAEELEKDFAPFAALSDAPMAMTAHIAYQAFDPDVAATISTKVIRDVI
RGRIGFDGLLMGDDLGMKALGGTLESRARASFDAGCDIALHCAGFEKDPDAILMQMRQVA
SACPRLVGRSEERAKIAEDATLHRQPFDIDAGRRRFDDLLGQISLHEVGEDPTGRAMA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccaaagcatgcattctgagtgtttccggacctgaacttctggatgaagaa
gctatctttttagcacagcataacccgtggggaattattctcatgggtcgctctgttaaa
tcaagaaagcaagtacgtgcgcttgtggatgcaatttggtctgctctggggcggccttgt
cttgtttttatagatcaggaaggcggcagagttcgccgtatgcgcccacctgagtggccg
gaatttcctgccggtgaagcatatgcaagactgtaccaaaaatcgcctgagctgggtaaa
gaagctgcttggcttggtcacagattgatggccgctgaacttcagcctctaggtatattt
gccgattgtgcgccaattttagatttattgcatcatgatgcgcatgatattgttggagat
cgtgcttttggatcttcgccgcaacaagtggctgaaattggctctgctgctattaaagga
ctcatggatggcggtgttgcgagcgttataaaacacatacccggacatggccgcgcgaaa
caagatagtcatgaagcacttcctgttgttgatgccagtgccgaagaattagagaaagat
tttgcgcccttcgctgcattaagtgatgcccccatggcaatgactgctcacattgcgtat
caggcatttgacccagatgttgctgcaacaatctcaacaaaagttattcgagatgtcatt
cgtggacgtataggttttgatggtcttttaatgggtgatgatcttggcatgaaagcgctt
ggtggcactttagaaagccgtgcaagagcaagttttgatgctgggtgcgatatcgcgctt
cattgtgctggttttgaaaaagaccctgatgctattttgatgcagatgaggcaagtggct
tctgcctgtccgcgcttagtcgggcggtcagaagaaagagcgaaaatcgccgaagatgca
acattgcaccgtcagccatttgatattgatgcaggacggcgacgctttgatgatttgctt
gggcaaatatcgcttcacgaggtcggagaagatccaactggtcgggcgatggcttaa

DBGET integrated database retrieval system