KEGG   Hirschia baltica: Hbal_1403Help
Entry
Hbal_1403         CDS       T00945                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hba  Hirschia baltica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1465844..1466491
Genome map
AA seq 215 aa AA seqDB search
MSVVDPFRAARLVLLLRQAGVRDNRVMSAIEKTPRAVFVPPEYRDMAYDNLKVPIACGQE
LSLPVVVGQMLQALNVQPDHDVLEVGTGVGYQAAILSLLAKRVYTVERFRTLHEKAAETL
LSLELDNIRLFHGDGMEGLQERAPFDRIILTGAISRPPYTLAQQLKSEGILVAPVEKDGS
QQINVYKRVGNQVEKLTTLGASKFLPLIIGTAREL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtagtggatccatttagagctgcgcggcttgttttattgctgcgtcaagccggt
gtgcgggacaatcgtgtgatgagcgcgattgaaaaaacgccgcgcgctgtttttgtgcct
cccgaatatcgcgacatggcttatgacaatttaaaagtcccaattgcgtgcggacaggaa
ctttccctccctgttgtcgtcggccaaatgctgcaagcgctgaatgttcagcctgatcac
gatgttttagaagtgggaaccggagttgggtatcaagccgcgattttatctttgcttgca
aaacgggtttacaccgtagagcgttttagaaccctgcatgaaaaagcagccgaaacactg
ttatctttggagctagacaatattcgcttattccatggcgatggcatggaagggctgcaa
gaacgtgcgccatttgatcgtatcatacttacgggtgcaattagtcgcccgccttacact
ttggcgcaacagttgaaatccgagggcatattggttgcgccggtagaaaaagacggctca
caacagataaatgtttataaaagagtcggaaatcaagtcgaaaaactaaccacgttaggg
gcttctaagtttttacccctcattattggcactgcaagagaactttaa

DBGET integrated database retrieval system