KEGG   Hirschia baltica: Hbal_1545Help
Entry
Hbal_1545         CDS       T00945                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hba  Hirschia baltica
Pathway
hba00010  Glycolysis / Gluconeogenesis
hba00052  Galactose metabolism
hba00500  Starch and sucrose metabolism
hba00520  Amino sugar and nucleotide sugar metabolism
hba00521  Streptomycin biosynthesis
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01120  Microbial metabolism in diverse environments
hba01130  Biosynthesis of antibiotics
hba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbal_1545
   00052 Galactose metabolism
    Hbal_1545
   00500 Starch and sucrose metabolism
    Hbal_1545
   00520 Amino sugar and nucleotide sugar metabolism
    Hbal_1545
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hbal_1545
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hbal_1545
Enzymes [BR:hba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hbal_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACT59233
JGI: Hbal_1545
UniProt: C6XJD8
Position
complement(1629927..1630907)
Genome map
AA seq 326 aa AA seqDB search
MGKVVSEYVVVGDVGGTNVRFAVSKDPRRYGGPTKIEHFWKSPNVKYETFSDALDAFLAT
IDIKPKRAVFALAGPIRNNTVTLTNHSSWQVCGEELAKQFGMDQVDLLNDFAAMARSIPE
LGLNSDGQGLKTICEGISAPGRPIIVAGPGTGFGFATLIPNENKTWQVLRGEGGHQAFSP
TTALEADVYKRLLEKASYVSIESVSAGVGFNQLLETMFEVFGQTPEKLSPATAHERAKLG
DKVCDAVCRMRANTVMTAYGNAVLANGAKGGVVAAGGVTTALIDYISAPEALSRFFDRGP
MSSYMTDVPIYLITSAEAPLLGAAAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtcgtgtctgagtatgtagttgtcggcgatgtaggtggcacaaatgtgcgt
tttgctgtttcaaaagaccctcgtcgctacggaggtccaacaaaaattgagcacttttgg
aaatctcccaatgtaaaatatgagacgttttcagacgcattagatgcttttcttgcaaca
atagacatcaagcccaaaagagctgtttttgccttggctggaccaatccgtaacaacact
gtgactttaactaatcattctagttggcaagtttgcggagaagaactcgcaaagcaattt
ggaatggatcaagtagaccttctcaatgattttgcagcaatggctcgctccatccctgaa
ttaggtttaaattctgatggacaaggattgaaaacaatctgcgaaggcatttcggcaccc
ggaagacccattatcgtcgctgggcccggaacagggtttgggtttgcgacacttattcca
aatgaaaataaaacatggcaagttctacgtggtgagggaggccatcaagctttctcaccg
acgacagcgctagaagcagatgtctataagaggcttttagaaaaggcgtcctatgtttct
atcgaatcagtgagtgccggtgtcgggtttaatcaacttttagagaccatgttcgaagtt
tttggacagactcctgagaaactttcccctgcgacagcacatgaacgtgcgaaattaggt
gataaagtatgtgatgccgtttgcaggatgagagcaaacaccgtaatgacggcatacgga
aatgccgttttggctaatggtgcaaaaggtggtgttgttgctgcgggcggtgtaacgact
gctctgatcgactacatcagcgcgccagaagccttatcgcgctttttcgatcgtgggcct
atgtcatcttatatgactgatgttccaatatatttaatcaccagcgccgaagcgccattg
ttgggcgcagcagcatactaa

DBGET integrated database retrieval system