KEGG   Hirschia baltica: Hbal_1554Help
Entry
Hbal_1554         CDS       T00945                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hba  Hirschia baltica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hbal_1554
Enzymes [BR:hba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Hbal_1554
Transfer RNA biogenesis [BR:hba03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Hbal_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1641682..1642428
Genome map
AA seq 248 aa AA seqDB search
MSELSDAQLAAELADAAGKILLEVRASGLVDGKALGKTGDETSNAFLMQALAHQRPDDAV
LSEESKDDKSRLEKSRVWIIDPVDGTREYGEGRTDWAVHVALSIDGKPSIGAVALPGMDL
VLRSDQPPALKPMNNPPKMLVSRSRPGKEATAVAEAMGAELLPMGSAGAKAMAVVRGEAD
IYLHSGGQYEWDNCAPIAVANAAGLHTCRMDGSEFKYNCDDTYLPDLLICRPELADAARK
AIDALNLD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactaagtgatgcgcaattagcggcagagcttgctgacgctgcgggaaagata
cttttagaagttcgtgcgtcggggctagtcgacggaaaagcattaggaaaaacaggggat
gaaacctcaaatgctttcttgatgcaggcactggcgcaccagcggccagatgatgcggtt
ctgtctgaagaaagtaaggatgataaatcacgccttgaaaagtcacgcgtgtggattatc
gaccctgttgatggcacgcgcgaatatggcgaagggcgtactgattgggcggtgcatgtc
gcactatctatagatggaaaaccgtccatcggagctgttgctttgccggggatggattta
gtcttgcgctctgatcagccacctgcactaaaaccgatgaataacccgcccaaaatgttg
gtgtcacgctctcgccctggtaaagaggcgacagctgttgccgaagctatgggagctgaa
ttgcttccaatgggctcagctggtgctaaagcaatggctgttgtgcgcggcgaggcagac
atttatctgcattctggcgggcaatatgagtgggacaattgtgcaccaatcgccgtcgca
aatgcagcaggattgcacacctgccgcatggatggatcagaattcaaatataattgcgat
gatacttatcttcctgatctattgatctgccgccccgagcttgctgatgcagcccgcaaa
gcaatagacgctcttaatctagattaa

DBGET integrated database retrieval system