KEGG   Hirschia baltica: Hbal_1694Help
Entry
Hbal_1694         CDS       T00945                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hba  Hirschia baltica
Pathway
hba00010  Glycolysis / Gluconeogenesis
hba00051  Fructose and mannose metabolism
hba00562  Inositol phosphate metabolism
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01120  Microbial metabolism in diverse environments
hba01130  Biosynthesis of antibiotics
hba01200  Carbon metabolism
hba01230  Biosynthesis of amino acids
Module
hba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbal_1694
   00051 Fructose and mannose metabolism
    Hbal_1694
   00562 Inositol phosphate metabolism
    Hbal_1694
Enzymes [BR:hba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hbal_1694
Exosome [BR:hba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hbal_1694
  Exosomal proteins of bladder cancer cells
   Hbal_1694
  Exosomal proteins of melanoma cells
   Hbal_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACT59382
JGI: Hbal_1694
UniProt: C6XJT7
Position
complement(1807691..1808446)
Genome map
AA seq 251 aa AA seqDB search
MSNAKPLFVGNWKMNGFRANLTEILNVEESIAKTPFHGDVVICPPATLAALAVDALKKSV
IQIGGQDCHAEEAGAFTGDISAEKWKDLGAGYVIVGHSERRAYYQEDNKAVKAKSKAVLR
AGLVPIICIGESLEERKAGKTLEIISAQIDGCIPDEAQSAPIAVGYEPVWAIGSGLTPTL
EEISEAHKVIREALHKKIGDKADLTPIVYGGSLKPSNAKEILAILGVDGGLVGGASLKAV
DFLEIIRACDQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcaaaacccctctttgtagggaattggaaaatgaacggttttagggcgaac
cttacagaaattttgaatgtagaggaaagtatagcaaaaacaccttttcatggggatgtg
gtcatctgtcctcccgcaactctagcagcgttagcggtggacgctttaaagaaaagtgtc
attcaaatcggaggtcaggattgccacgcagaagaagcgggtgcctttaccggtgatatt
agtgcagaaaaatggaaagaccttggggccggctatgttatcgttggtcactccgaaagg
cgcgcttattatcaggaagataataaagctgtaaaagctaaatctaaagctgttctaaga
gcggggcttgttccaattatctgcattggcgaaagtctggaagaacgaaaagcgggtaaa
acacttgagattatttccgcccaaatagatggttgcatacctgacgaagctcaaagtgct
cctattgctgtaggatatgaaccagtatgggcgattggcagtggcctaacacctacactt
gaagaaatttccgaagctcacaaagtgattcgcgaagcattacataagaaaattggtgac
aaagcagacctaacccctatcgtttatgggggctcattaaagccttctaacgctaaggaa
atactggctatcctaggagtagacggtggtctggtaggaggcgcgagtttaaaagcagta
gatttccttgagataattcgagcctgcgaccagtaa

DBGET integrated database retrieval system