KEGG   Hirschia baltica: Hbal_1699Help
Entry
Hbal_1699         CDS       T00945                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hba  Hirschia baltica
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbal_1699
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbal_1699
Enzymes [BR:hba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hbal_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1813623..1814417
Genome map
AA seq 264 aa AA seqDB search
MKTALDKIIDYKREEVASLKIKLSASTLHSDALRRTPPRGFAQQMLSIAKTDENALICEI
KRKSPSAGNINTLKNPILAAQSYVDGGAACISVLTDGPSFGGSLEDMIAVRDAVSIPVLR
KDFMIDEIQILEARAAGADAILLIMSVLDKEHALSLHQCAEDLGMSILLEAHNEAELEQA
LSLPSPLVGVNNRDLKRMVTELETTERLSSMVPTDKLLISESGIKTTEDIHRLRKTGARG
FLIGESLMKSEDIVKSVRELRDIK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgcactcgataaaattattgactacaaacgagaagaagtagcatctttaaag
atcaaactatcagcaagtactcttcactcagatgccctgcgacggacgcctcctagaggt
tttgcacaacagatgttgtccattgccaaaactgacgaaaatgctctgatatgcgagata
aagcgaaagagcccatctgcaggcaatataaacacgctaaaaaacccaattttagcggct
caatcatatgttgatggcggcgctgcttgcatttccgtactcacggatggcccaagtttt
ggcggttccctcgaagatatgattgctgttagagatgctgtatcaatcccagtccttcgc
aaagattttatgattgatgaaattcaaatattagaagcccgtgcagcaggtgctgacgct
attcttctgatcatgtctgttttagataaagagcacgctttgagtctgcatcaatgtgct
gaagacctaggtatgtctatattattagaggcacataatgaggctgaattagaacaagcc
ctgtcacttccctctccactcgttggggtcaataaccgtgaccttaagagaatggtgact
gaattagagacgacggaacgtttatcttccatggtgccaacagacaaattactgatttca
gaaagtggaattaaaaccacggaagatatacatcgtctccgtaaaacaggagcacgtggt
tttttgattggagaaagtctcatgaaatcagaagacatagttaaaagtgttcgagaactt
cgcgatataaagtaa

DBGET integrated database retrieval system