KEGG   Hirschia baltica: Hbal_2166Help
Entry
Hbal_2166         CDS       T00945                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hba  Hirschia baltica
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hbal_2166
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hbal_2166
Enzymes [BR:hba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hbal_2166
Two-component system [BR:hba02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Hbal_2166
Bacterial motility proteins [BR:hba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hbal_2166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2313350..2314405)
Genome map
AA seq 351 aa AA seqDB search
MSKIKVVVVDDSALMRRIIPSLLEKTGEIEVVATAPDPIIARQKIKLTNPDVITLDVEMP
KMDGISFLEKIMSLRPMPVVMISSLTTKSADVTLRALELGAVDFVTKPALDLAANMETMS
QELIEKVKTAATSNIQRRRTAPVQVTNKTFTSFETTENLVAIGASTGGVETLGRLLPKLP
RNSPAILITQHMPPNFTRQFAERLNKTCAVTVREAENNQRVRPGEVWISPGSQHLTLKRS
GADYICKLSDAPAVNGHRPSVDVLFDSVAEHCGSKAIGVILTGMGKDGAKGLLNMKQAGA
KTFGQDEATSIVYGMPRAAFEIGAVDQQLREDAIIEEVLDAAAAKSNAIRI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcaaagttgtagtggtcgatgatagtgccttgatgcgtcgcataatccct
tccttacttgaaaagacaggggagatagaagttgttgcaactgcaccggatccgattatc
gctcgtcaaaaaataaaattaaccaatcctgatgttataactctcgatgtagagatgcct
aaaatggatggtatctcttttcttgaaaaaatcatgtccctaagaccaatgcctgttgtg
atgatttcttcactgacgacaaaaagtgctgatgtcactctgcgtgctttagaactagga
gcagttgattttgtgacgaagcctgctctcgatcttgctgctaatatggaaaccatgtcg
caagagcttatagaaaaggtaaaaacggctgcaacctccaatattcaacgtcgtcgaact
gcgcctgttcaggtcacgaataagacgttcacgtcattcgaaaccactgaaaatttagtc
gcaataggcgcatcgactggtggtgttgagacgttgggaagattacttcctaaattgccg
cgtaattctcctgcaatactgattacccaacacatgccacccaattttacgcgacaattt
gccgaaagattaaataaaacgtgtgcggttacagtacgtgaggccgaaaataatcaaagg
gttcgtcccggtgaagtttggatttctcctggaagccagcatctgacacttaaacgttcg
ggagctgattatatctgtaagttgagtgatgcgcctgcggtcaatggtcatagaccatct
gttgatgtgctttttgactctgtcgcagaacactgtggttcaaaggcaataggcgttatt
ttgacgggaatgggtaaggatggtgccaaagggctgctgaacatgaaacaggccggtgct
aaaacctttggacaagatgaagcgacgagcatcgtttatggcatgccccgagctgctttt
gaaataggcgctgtggatcagcagcttcgtgaagatgcaataattgaggaagtgttggat
gcagcggctgctaagtcgaatgcaatacgaatctaa

DBGET integrated database retrieval system