KEGG   Hirschia baltica: Hbal_2244Help
Entry
Hbal_2244         CDS       T00945                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hba  Hirschia baltica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbal_2244
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hbal_2244
  Amino acid metabolism
   00310 Lysine degradation
    Hbal_2244
Enzymes [BR:hba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Hbal_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2400767..2402263)
Genome map
AA seq 498 aa AA seqDB search
MADITVPVLGESVTEATVGSWSKAPGDAVAKDEVLVELETDKVSVEVSAAEDGVLTEILA
KEGDNVEIGALLGRISAGDGAKAEPASAPAATSAAPAATSGSGEQVKVAVPAMGESVTEG
TLSQWLKQPGDAVAVDDPIAEIETDKVAIEVPAPVAGVLSETLIAEGTTVGIGTEIAIIA
AGASASAAPAAAPASAPAASSASADSSAAVAPSVRRISAENNVNPSDIPGTGRDGRATKG
DALNFVANGESKPAPAAAPSAPRATGPREERVKMTRLRQTIARRLKEAQNTAAMLTTFND
VDLTEVMAIRKKYKDLFLEKHGVKLGFMSFFTKAVTHALKELPAVNAEIDGTDLIYKNYY
DISMAVGTDKGLVTPVVRDADQMSLAQIEAEIGRLGKLARDGKLAMSDLQGGTFTITNGG
VYGSMMSTPILNPPQSGVLGMHRIEQRPVAINGEVKIRPMMYLALSYDHRIVDGKEAVTF
LVRVKENLEDPERLLLDL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggccgatattacggtcccagtattgggcgaaagtgttaccgaagcaacggttggttct
tggtcaaaagcgccaggtgatgcagtcgctaaggatgaagtgcttgttgaattggaaact
gataaagtttctgttgaagtatcagctgctgaagatggtgtgttgacagaaattttggcg
aaagagggtgataacgtcgagattggcgcacttctcggacgtatcagtgctggtgacggc
gctaaagcagagccagcttctgcgccggctgctacatcagcagcacctgctgcaacaagc
ggctctggtgagcaagttaaagttgctgtgcctgccatgggcgaaagtgtaactgaagga
acattgtctcagtggttgaagcaacctggtgatgctgttgctgttgatgacccgattgct
gaaattgaaactgacaaggttgcgatagaagtgccggctccagttgcgggtgtgttgtca
gagacgctgatcgcagaaggtacaactgttggaatcggaacggagatcgctatcattgca
gcgggtgcctctgcgagcgccgctcctgctgcagctccagcatctgcgccagcagcttct
tctgcatctgcagattcaagcgcggctgttgcgccgtctgtgcgtcgcatctcagctgag
aataatgtgaacccatctgatattcctggaactggccgcgatggtcgtgcaacgaaaggt
gatgcattgaattttgttgcaaatggcgagtctaagcctgcgccagccgctgcaccgtct
gcaccacgtgcaacaggtccacgtgaagaacgtgtgaaaatgacacgtctgcgtcagaca
attgcacgtcgattgaaagaagctcaaaacactgcagccatgctgacaacatttaacgat
gttgatttgactgaagtcatggcaattcgtaaaaagtacaaggacttgttcttggaaaaa
cacggtgtgaaacttggtttcatgtctttcttcacaaaagctgtgacgcacgcccttaaa
gaacttcctgcagttaacgctgaaattgatgggacagatcttatctataaaaactactac
gacatttcgatggctgtagggacagataaaggtcttgtgacaccagttgttcgtgatgcg
gatcaaatgagcttggcgcaaatcgaagctgaaattggtcgtttagggaagcttgcgcgt
gacggtaaattggcaatgtctgaccttcagggcggtacattcacaattacaaatggcggt
gtgtatggctcaatgatgtcaacaccaattttgaacccaccacaatctggtgtgcttggt
atgcaccgcattgagcagcgtccagttgctatcaatggtgaagttaaaatccgtccaatg
atgtatctggcattatcatatgaccacagaattgtggatggtaaggaagcggtgacattc
ttggtgcgcgtgaaagagaatttggaagacccagagcgtttattgcttgacctctaa

DBGET integrated database retrieval system