KEGG   Hirschia baltica: Hbal_2344Help
Entry
Hbal_2344         CDS       T00945                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hba  Hirschia baltica
Pathway
hba00260  Glycine, serine and threonine metabolism
hba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01130  Biosynthesis of antibiotics
hba01230  Biosynthesis of amino acids
Module
hba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbal_2344
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbal_2344
Enzymes [BR:hba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hbal_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA His_biosynth Pterin_bind ALF
Motif
Other DBs
NCBI-ProteinID: ACT60024
JGI: Hbal_2344
UniProt: C6XMW0
Position
complement(2499314..2500138)
Genome map
AA seq 274 aa AA seqDB search
MPISRISAAFEKAKTQNRAAFVTYMMCGDPDLETSFEAAQALAENGADIIELGAPFTDPM
ADGPAIQKAAQRSLKAGTKLADVLSVAKRFRETNQDTPLIIMGYANPIHKMGYKAFAEAA
ADSGVDGVITVDLPPEEDAELRGYLADLELAVIRLATPTTTQARMETVANGSSGFVYYVS
VAGITGAGTGAQTDIKAGVDRAKNASGLPVAVGFGVKTAEQAAEFSRLADGVVVGSAIVE
EVRMAVEAGMPSDAPRRMGTLVKVLSDAIAESRS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctatttcccgtatatctgctgcttttgaaaaagctaaaacacaaaaccgcgcagcg
tttgtgacctatatgatgtgtggtgatccagatctggaaacatcttttgaggcagctcaa
gcgctcgctgagaatggtgcggatattattgaactgggcgcaccttttactgacccaatg
gcagatggtccggctattcaaaaagcggctcaacgctccctaaaagcaggaacgaagttg
gcggatgttttgtctgtcgcaaaacgtttccgcgaaacaaatcaagatactccgctaatt
atcatgggatatgcaaaccctatccataaaatgggttataaggcatttgcagaggcagcc
gcagattcaggtgtagatggtgttatcactgttgatttaccacctgaagaagatgcggaa
ttgcgcggataccttgcagacttggaactcgccgttattcgtctagcaacaccgacgacg
acgcaagcgcgtatggaaacggttgccaatggatcatcgggttttgtttattatgtgtct
gttgctgggattactggcgcaggaacaggtgcgcaaacagatattaaagcgggtgtagac
cgcgcaaaaaatgcatctggcttaccagttgctgtaggttttggagtcaaaacagccgag
caggcagctgaattttctcggctagctgatggtgttgttgttggttctgctattgttgaa
gaagttcgtatggctgttgaagcaggtatgccgtctgatgcaccaaggcgtatggggacg
ctggtaaaggtgctttcggatgcaattgctgaaagtcgatcataa

DBGET integrated database retrieval system