KEGG   Hirschia baltica: Hbal_2344Help
Entry
Hbal_2344         CDS       T00945                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hba  Hirschia baltica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbal_2344
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbal_2344
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbal_2344
Enzymes [BR:hba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hbal_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2499314..2500138)
Genome map
AA seq 274 aa AA seqDB search
MPISRISAAFEKAKTQNRAAFVTYMMCGDPDLETSFEAAQALAENGADIIELGAPFTDPM
ADGPAIQKAAQRSLKAGTKLADVLSVAKRFRETNQDTPLIIMGYANPIHKMGYKAFAEAA
ADSGVDGVITVDLPPEEDAELRGYLADLELAVIRLATPTTTQARMETVANGSSGFVYYVS
VAGITGAGTGAQTDIKAGVDRAKNASGLPVAVGFGVKTAEQAAEFSRLADGVVVGSAIVE
EVRMAVEAGMPSDAPRRMGTLVKVLSDAIAESRS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctatttcccgtatatctgctgcttttgaaaaagctaaaacacaaaaccgcgcagcg
tttgtgacctatatgatgtgtggtgatccagatctggaaacatcttttgaggcagctcaa
gcgctcgctgagaatggtgcggatattattgaactgggcgcaccttttactgacccaatg
gcagatggtccggctattcaaaaagcggctcaacgctccctaaaagcaggaacgaagttg
gcggatgttttgtctgtcgcaaaacgtttccgcgaaacaaatcaagatactccgctaatt
atcatgggatatgcaaaccctatccataaaatgggttataaggcatttgcagaggcagcc
gcagattcaggtgtagatggtgttatcactgttgatttaccacctgaagaagatgcggaa
ttgcgcggataccttgcagacttggaactcgccgttattcgtctagcaacaccgacgacg
acgcaagcgcgtatggaaacggttgccaatggatcatcgggttttgtttattatgtgtct
gttgctgggattactggcgcaggaacaggtgcgcaaacagatattaaagcgggtgtagac
cgcgcaaaaaatgcatctggcttaccagttgctgtaggttttggagtcaaaacagccgag
caggcagctgaattttctcggctagctgatggtgttgttgttggttctgctattgttgaa
gaagttcgtatggctgttgaagcaggtatgccgtctgatgcaccaaggcgtatggggacg
ctggtaaaggtgctttcggatgcaattgctgaaagtcgatcataa

DBGET integrated database retrieval system