KEGG   Hirschia baltica: Hbal_2346Help
Entry
Hbal_2346         CDS       T00945                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hba  Hirschia baltica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbal_2346
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbal_2346
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbal_2346
Enzymes [BR:hba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hbal_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2500466..2501680)
Genome map
AA seq 404 aa AA seqDB search
MDTRNTWNKWPDESGRFGEFGGRYVAETLMPLILDLEKEYEAAKADPEFEKLYRGLMQDY
VGRPSAMYFAERLTEHFDGAKIYFKRDELNHTGSHKVNNCLGQVLLALRMGKTRIIAETG
AGQHGVATATICARFGLPCTVFMGATDVERQKPNVFRMKLLGAEIVPVSSGTGTLKDAMN
EALRDWVTNVHDTFYCIGTAAGPHPYPAMVRDFQSVIGREAKAQIMEREGRLPDVVMACI
GGGSNAIGLFHPFLEDENVRMIGVEASGHGIETGEHAAALNGGEPGILHGNRTYLLQDGD
GQIIDAHSISAGLDYPGIGPEHSFLKDTGRAEYLTCTDKEALDAFQLCTKLEGIIPALEP
AHAIARVGDVARELGKDGLIIMNLCGRGDKDVFSVAGHLGIDID
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgcaatacttggaataaatggcctgacgaaagcggacgttttggagagttt
ggtggacgctatgttgccgagactttaatgccgcttatcctcgatcttgaaaaagaatac
gaagctgcaaaagcagacccggaatttgaaaagctatatcgaggcttgatgcaggattat
gtggggcgtccatcggcaatgtattttgctgaacgcttaacagagcattttgatggtgcg
aaaatatatttcaagcgggatgaactaaaccatacaggatcacacaaggtgaataactgt
ctggggcaagtactattggctttgcgcatgggcaagacccgcattattgctgaaactgga
gcagggcagcacggcgtggcaacagctactatctgtgcacgctttggacttccatgtact
gtgtttatgggggcgactgatgtagagcgccaaaaaccaaatgtgttccgcatgaagcta
ttgggcgctgaaattgtacccgtatcatcaggaacaggcacgctgaaagacgcgatgaat
gaagcattgcgcgattgggtgacgaatgtgcatgatacattttattgtatcgggacagcc
gctggtccacacccatacccagctatggtgcgtgatttccaatctgtcattggccgtgaa
gctaaagcacagattatggaacgcgaaggtcggcttccagatgttgttatggcgtgtatt
ggcggcggatctaacgcgataggattattccatccattcttagaagatgaaaacgtaaga
atgatcggtgtggaagcatcaggccatggtatcgagacaggcgagcacgcggcagccctc
aacggcggagagccgggtatcctgcatggaaatcgcacatatctgcttcaagatggtgat
gggcagattatagatgcgcattctatctctgcagggttggactatccgggtatcggacct
gagcattccttcctgaaggatacaggccgcgctgaatatctgacatgcactgacaaagag
gctctggatgcttttcagctatgtacaaaactagaaggtatcattcccgcgcttgaaccc
gcacacgcaattgcgcgcgttggtgatgttgctagggagttgggtaaagatggcctcatc
ataatgaacttatgtgggcgtggtgataaagatgtattctctgtcgcgggtcatcttgga
attgatattgattag

DBGET integrated database retrieval system