KEGG   Hirschia baltica: Hbal_2379Help
Entry
Hbal_2379         CDS       T00945                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hba  Hirschia baltica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hbal_2379
Enzymes [BR:hba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Hbal_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2533150..2533764
Genome map
AA seq 204 aa AA seqDB search
MDAIVKDGAVTRDNNDKRPTREEAEKAVKTLLAWAGDDPEREGLLDTPKRVVKAYEEWFS
GYRDDPVKYLSRTFEDVQGYDDIVMLRDIDVESHCEHHMAPFMGKAYVAYMPTDSVVGIS
KLARVVEIYAKRLQTQETMTSQICEAIEESLKPAGVAVMIDAVHQCMTTRGVHHPNVSTI
TTQFTGVFKTDKDLRDRFLRLSER
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgctatagttaaagatggtgccgtgacgcgcgataataatgataagcgccctacg
cgcgaagaagctgaaaaagctgtaaaaacgctccttgcatgggctggtgatgatccagaa
cgtgaaggtcttttagatacgccaaaacgcgtggtaaaagcctatgaagaatggttctca
ggctatcgtgacgaccctgtaaaatatctatcaaggacatttgaagacgtgcaaggctat
gacgacattgtaatgcttcgcgacattgatgtcgaaagccactgcgaacaccacatggcc
ccttttatgggtaaagcttatgtcgcctatatgccaacagattcagtcgtgggcatatcc
aaactagctcgtgttgttgagatatacgcaaaacgcctgcaaacacaggaaacaatgacg
tcgcaaatttgtgaagccattgaagaaagcctgaaacctgctggtgtggccgtgatgatt
gatgctgttcaccaatgcatgacaacacgcggtgttcaccacccgaatgtctctacgatt
acaactcagtttacgggtgtattcaaaacagacaaagacctacgtgaccgctttctacgt
ttgagcgaacgctaa

DBGET integrated database retrieval system