KEGG   Hirschia baltica: Hbal_2420Help
Entry
Hbal_2420         CDS       T00945                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hba  Hirschia baltica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbal_2420
   00030 Pentose phosphate pathway
    Hbal_2420
   00051 Fructose and mannose metabolism
    Hbal_2420
   00052 Galactose metabolism
    Hbal_2420
   00500 Starch and sucrose metabolism
    Hbal_2420
   00520 Amino sugar and nucleotide sugar metabolism
    Hbal_2420
  Nucleotide metabolism
   00230 Purine metabolism
    Hbal_2420
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hbal_2420
Enzymes [BR:hba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hbal_2420
    5.4.2.8  phosphomannomutase
     Hbal_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2572331..2573854
Genome map
AA seq 507 aa AA seqDB search
MPMMPKANIAANTLEFETTPLVKPTGFREYDARWWFGIDGNSKAPELNYLGVQALGLGLG
TVVHQMGVEPKIVVGHDYRSYSIAIKQALIVGLIEAGMEVHDIGLALSPTAYYSQFALDI
PCVAMVTASHNENGWTGVKMGANKPLTFGPDEMGQLRDVVLNGKFEPRDGGKLIRVEGMR
EKYIESVSDKIEIKRPLKVIAACGNGTAGAFAPDALRNMGVEVIELDCELDHSFPNYNAN
PEDSVMLEAMAKALKEHDADVALGFDGDGDRCGVVDNTGEEIFADKIGLMLSRDLSKNYP
NAKFVVDVKSTGLYKTDPVLKENGATVDYYKTGHSYIKRRTTDLDALAGFEKSGHFFFRP
PLGYGYDCGLVAAAEVLRMLDRNPDKTIAQLKDELGIAYTSLTMAAHCDDEIKYGVVDKV
VAAYETLGKEGASILGRKIVEVNTVNGARVTLEDGSWVLVRASSNKPELVVVVESMVSDE
DMRALFREEVKPRLAAFDEVGAYNQEI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgatgccaaaagcaaatatcgcagcaaatacacttgaatttgaaacaacacca
ctcgtgaagcctacaggttttcgagaatatgatgcgcgttggtggttcggtattgacggt
aattctaaagctcctgaattaaactatttaggtgtacaggcgctagggcttggtttgggt
actgtcgtgcaccaaatgggcgtggaaccaaaaatcgtcgttggacatgactaccgctct
tactcaatcgcaatcaaacaagcacttattgttggcctcattgaagccggcatggaagtc
cacgacatcggactcgcactatcccccacagcttattattctcaatttgcactcgatatt
ccttgtgtcgccatggtaaccgcatcccacaacgaaaatggttggactggtgtcaaaatg
ggtgccaacaaaccgctcacttttggacctgatgaaatgggtcaacttcgtgatgtcgtc
ctcaatggaaagttcgagccgcgtgatggtggtaaacttatccgcgttgaaggcatgcgc
gaaaaatacatcgagtccgtgtccgacaaaattgaaatcaaacgccctctcaaagtcatt
gcagcatgtggtaatggaacagccggtgcattcgcaccagacgcccttcgcaatatgggt
gttgaagttattgaacttgattgtgaacttgatcactccttcccaaactataacgccaac
cctgaagattcagtcatgcttgaagcaatggctaaagcgctcaaagaacatgatgctgat
gttgcgctcggctttgatggtgatggagaccgttgcggtgttgtcgacaatacaggtgaa
gaaattttcgctgataaaatcggcctaatgctttcgcgtgacctttctaaaaactatcca
aatgcaaaattcgtggtcgatgtaaaatccaccggtctctacaaaactgatccagttttg
aaagaaaatggtgcaacagtagactattacaaaactggccactcatacattaagcgtcgc
acaaccgaccttgatgctctcgctggatttgaaaaatcagggcacttcttcttccgtcca
ccacttggatatggatatgattgtggtcttgtggctgctgctgaagtcttgcgtatgttg
gaccgcaacccagataaaacgattgcacagctaaaagacgaactcggcattgcatacaca
tctttgacaatggcagcccattgtgacgatgaaatcaaatacggtgtcgtcgataaagtt
gttgcagcctatgaaacacttggaaaagaaggtgcatcaattcttggacgtaaaatcgtt
gaagtgaacacagtaaatggtgcacgtgtaactttagaagatggctcatgggttttggtt
cgcgcatcatctaacaagccagaattggtcgtcgtggttgaaagcatggtgtcagacgaa
gatatgcgtgctcttttccgtgaagaagtcaaacctcgcttggctgcttttgatgaagtt
ggtgcatacaaccaagaaatctaa

DBGET integrated database retrieval system