KEGG   Hirschia baltica: Hbal_2422Help
Entry
Hbal_2422         CDS       T00945                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hba  Hirschia baltica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hbal_2422
   00052 Galactose metabolism
    Hbal_2422
   00500 Starch and sucrose metabolism
    Hbal_2422
   00520 Amino sugar and nucleotide sugar metabolism
    Hbal_2422
Enzymes [BR:hba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hbal_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576279..2577175
Genome map
AA seq 298 aa AA seqDB search
MAIKPVRKAVLPVAGFGTRVLPATKSIPKEMMPVFDRPAIDHVVREALEAGIEHIVFVTG
RNKGAIEDYFDSAYELEDSLSKRSGKEAILAEVQATTLPAGSTSFTRQQTAKGLGHAVLC
AKDIIGDEPFAVLLPDVLVNSKVSCLKQMMDSYNEVGGNIIAVDEVPMERVHKYGVIKPA
AGADVSKKLIKMDAMVEKPATEDAPSNLKITGRYILQPEIFALLETQSAGAGNEIQLTDS
MERLMAKQEFYASRFDGDDYDCGDKMLYLQAQAGYALADKEHSAQAREILEALLKKFS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctattaaacccgtacgtaaggcagttctacctgtcgcaggatttggaacacgcgta
ctaccagcaacaaaatcgattccaaaagaaatgatgccggtatttgatcgtccagcaatc
gaccacgtggttcgtgaagcgcttgaagccggtattgaacacatcgtctttgtaacgggt
cgcaataaaggtgctatcgaagattattttgacagcgcatatgagctagaagacagcctg
tccaaacgttccggcaaagaggcaatcttagctgaagtacaagcgacaacgcttcctgca
ggatcaacaagctttacgcgccaacaaacagcaaaaggtcttggccatgctgttttatgt
gccaaagacattatcggcgatgaaccatttgctgttctgcttccagatgttttggtcaac
agcaaggtctcctgcttaaagcagatgatggacagctataatgaagttggtggcaatatc
attgctgtggatgaagtcccaatggaacgtgttcacaaatatggtgtgatcaaaccagct
gccggagctgatgtttccaaaaagctgattaaaatggatgctatggttgaaaagccagcg
acagaagatgcaccttccaaccttaagatcactggtcgctatatcctacaaccagaaatt
ttcgcgcttcttgaaacacaaagcgccggtgctggtaatgaaattcagttgactgactcc
atggaacgtttgatggcgaagcaagaattctatgcgtcccgttttgacggtgacgattat
gattgtggtgacaagatgctttatcttcaagctcaagctggctacgcactcgctgacaaa
gaacacagcgcacaagctcgtgaaatcctcgaagcactattgaaaaaattcagctaa

DBGET integrated database retrieval system