KEGG   Hirschia baltica: Hbal_2549Help
Entry
Hbal_2549         CDS       T00945                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hba  Hirschia baltica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hbal_2549
Enzymes [BR:hba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hbal_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2742422..2743345)
Genome map
AA seq 307 aa AA seqDB search
MIGSVNLDVVATVENLPRPGETVIASSLEYFLGGKGANQAVAAQKVGVETVFYACIGDDS
EASFLVDNLTKVGVDVAQVKTKSKTFSGRAYINVDHAGENEVVVLPGANAELEFDESKLD
DATAVALAQLETAIEPTVQFFKSCQKKHAMTILNAAPFVAEARLKLFELSDIIIVNEVEL
AGYCGVDEIPEDVEDIILLLRSLISRNDQAVIVTCGAAGALCVHGKDVIVVAARFTQVVD
STGAGDCFSGVLAAGIVQGLSLKEALQRASIASSLSVESKGASASSPFLADIEAEIQKNQ
ITEGAET
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgattggcagcgtcaatctagatgttgttgcaacagttgaaaatctacctagacccggt
gaaaccgtaatagctagttcgttggaatattttttgggtggaaagggtgccaaccaagct
gtggctgctcaaaaggtaggggttgaaacggttttttatgcatgtatcggagacgattct
gaagcatcatttctagtcgacaatttgacaaaagtcggggtggatgttgcgcaggtgaaa
accaagtcgaaaacattttctggtcgcgcttatatcaacgttgatcatgctggtgaaaat
gaagttgttgttttgccgggtgcgaatgcggaacttgaatttgatgaaagcaaattagat
gacgccacggcggtcgcgttggcgcagcttgaaactgcaatcgagccgactgttcaattt
tttaagagttgtcaaaaaaaacatgcgatgactattttgaatgccgctccgtttgtggct
gaagcgcgactaaaattatttgaattgtcagatattattattgtcaacgaagttgagttg
gcagggtattgtggcgtcgatgaaattcctgaagacgtggaagatattatacttctactc
cgtagtttgatcagtcgaaatgatcaggctgtcatcgttacgtgcggcgctgctggtgct
ctttgtgttcatggtaaagatgtcatcgttgtagcggctcggtttacacaagtcgtcgac
tctacaggcgctggtgattgtttttcaggtgtgctggcggcaggtatcgttcaagggctt
tcacttaaagaagctctacagcgtgcaagtatcgcttcttcattatcagttgagagcaaa
ggtgcgagtgcgtctagtccattcttggctgacattgaggccgaaattcaaaaaaatcaa
ataactgagggagctgaaacttga

DBGET integrated database retrieval system