KEGG   Hirschia baltica: Hbal_2622Help
Entry
Hbal_2622         CDS       T00945                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hba  Hirschia baltica
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hba00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hba00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2844596..2845738
Genome map
AA seq 380 aa AA seqDB search
MPTSRLLASFPLVGALLAACQSTNLPEAQSLEFSVQETCEATPNCFTNIQDALNAASALN
SSDWKTVSVAAGDYYEKLTIRDAKTRLIGEGIETTRIHYDAVAETAGKFHRQNWGTAGSA
TITVDAEDVHIEGFKIENTFDYISNDKLDNDDPKRISNSQAAALLLDIHSDKVYLNKVTL
EGYQDTVFANGKRAFISNSFISGNVDFIFGNGQLLIEDSEIQSRRRGQDFEAGEVQSFIA
APSTQISDRMGIVFHTCRLTPEEGLPNHSITLGRPWHPTTRFPDGRYADPNAIGQAIYIN
TFMDSHIHPDHWSTMNGTARNGEKTDVFHPEDSRFHEVGSYGPGAKTSFKGTSYTDFPDM
AEINTIMFDDWNEFKNRLDE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatctcgtcttttagctagtttccctcttgttggagccctgctcgctgcctgc
caatctacaaatttacctgaggcccaatcacttgagttttcggtgcaggaaacttgcgaa
gcgacacccaactgtttcacaaatattcaagacgcactgaacgccgcatcagcactaaat
agctctgattggaagacagtgtctgtcgccgcgggtgattactacgaaaaactcaccatt
cgagatgctaaaacccgtttaattggtgaaggtatcgaaactacacgcattcattacgat
gcagttgcggagaccgctgggaaattccatcgccaaaactggggaaccgcaggatctgct
actataactgtcgatgcagaagacgtgcacattgaaggtttcaaaattgaaaatacattt
gattacatatccaatgacaaattggacaatgatgacccaaaacgcatatcaaactctcag
gccgccgccctattgctcgatatccacagtgacaaagtctatttgaacaaagtcactctg
gaaggctatcaagatacagtctttgccaacggaaaacgagccttcatatcaaatagcttt
atttccggaaatgttgattttatcttcggcaatggtcaattgttgattgaagacagtgaa
attcaatcgcgccgacgaggccaagattttgaagctggagaagtgcaatcatttatcgct
gctccctcaactcaaatttcagatcgaatgggaattgtatttcatacctgccgtctaaca
ccagaagaaggcttgccaaaccactcgatcacccttgggcgtccttggcaccctactacc
cgcttccctgatgggcgatatgctgaccccaatgcgattggccaagccatttatatcaac
acgtttatggattctcatattcatccagaccattggtcaactatgaatggaaccgccaga
aatggtgagaagacagacgtcttccaccctgaagactcaaggtttcacgaagtaggttct
tatggccctggcgcaaaaacgtcttttaaaggcacaagctataccgactttccagacatg
gccgaaatcaatacaatcatgttcgatgactggaacgagtttaaaaataggttagacgaa
taa

DBGET integrated database retrieval system