KEGG   Hirschia baltica: Hbal_2622Help
Entry
Hbal_2622         CDS       T00945                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hba  Hirschia baltica
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hbal_2622
   00500 Starch and sucrose metabolism
    Hbal_2622
Enzymes [BR:hba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Hbal_2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2844596..2845738
Genome map
AA seq 380 aa AA seqDB search
MPTSRLLASFPLVGALLAACQSTNLPEAQSLEFSVQETCEATPNCFTNIQDALNAASALN
SSDWKTVSVAAGDYYEKLTIRDAKTRLIGEGIETTRIHYDAVAETAGKFHRQNWGTAGSA
TITVDAEDVHIEGFKIENTFDYISNDKLDNDDPKRISNSQAAALLLDIHSDKVYLNKVTL
EGYQDTVFANGKRAFISNSFISGNVDFIFGNGQLLIEDSEIQSRRRGQDFEAGEVQSFIA
APSTQISDRMGIVFHTCRLTPEEGLPNHSITLGRPWHPTTRFPDGRYADPNAIGQAIYIN
TFMDSHIHPDHWSTMNGTARNGEKTDVFHPEDSRFHEVGSYGPGAKTSFKGTSYTDFPDM
AEINTIMFDDWNEFKNRLDE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatctcgtcttttagctagtttccctcttgttggagccctgctcgctgcctgc
caatctacaaatttacctgaggcccaatcacttgagttttcggtgcaggaaacttgcgaa
gcgacacccaactgtttcacaaatattcaagacgcactgaacgccgcatcagcactaaat
agctctgattggaagacagtgtctgtcgccgcgggtgattactacgaaaaactcaccatt
cgagatgctaaaacccgtttaattggtgaaggtatcgaaactacacgcattcattacgat
gcagttgcggagaccgctgggaaattccatcgccaaaactggggaaccgcaggatctgct
actataactgtcgatgcagaagacgtgcacattgaaggtttcaaaattgaaaatacattt
gattacatatccaatgacaaattggacaatgatgacccaaaacgcatatcaaactctcag
gccgccgccctattgctcgatatccacagtgacaaagtctatttgaacaaagtcactctg
gaaggctatcaagatacagtctttgccaacggaaaacgagccttcatatcaaatagcttt
atttccggaaatgttgattttatcttcggcaatggtcaattgttgattgaagacagtgaa
attcaatcgcgccgacgaggccaagattttgaagctggagaagtgcaatcatttatcgct
gctccctcaactcaaatttcagatcgaatgggaattgtatttcatacctgccgtctaaca
ccagaagaaggcttgccaaaccactcgatcacccttgggcgtccttggcaccctactacc
cgcttccctgatgggcgatatgctgaccccaatgcgattggccaagccatttatatcaac
acgtttatggattctcatattcatccagaccattggtcaactatgaatggaaccgccaga
aatggtgagaagacagacgtcttccaccctgaagactcaaggtttcacgaagtaggttct
tatggccctggcgcaaaaacgtcttttaaaggcacaagctataccgactttccagacatg
gccgaaatcaatacaatcatgttcgatgactggaacgagtttaaaaataggttagacgaa
taa

DBGET integrated database retrieval system