KEGG   Hirschia baltica: Hbal_2742Help
Entry
Hbal_2742         CDS       T00945                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
hba  Hirschia baltica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hbal_2742
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hbal_2742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3002873..3003265
Genome map
AA seq 130 aa AA seqDB search
MRIPTLPKISFVLATCTLATFAPTLSVAHADVEKGEKLFKLQCAVCHYVEPAKTKMGPSL
FGIVGSKSASSEGFRYSPAMKEAGLTWDAQTLDEFLASPRKAVPRTSMAFVGQKSEEKRA
DLIAYLETLK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccccactctgcccaaaatcagcttcgttttagcaacatgcacattagcaaca
tttgctcccaccctttctgtcgcacacgccgatgtagaaaaaggtgagaagctgttcaaa
ctccaatgtgctgtctgtcattatgtagaacccgccaagacaaaaatgggcccatctctt
tttggtattgtcggcagcaaatcagctagctcagaaggatttcgctactcacccgccatg
aaagaagcaggcctcacatgggatgcacaaactctggatgaattcctagcatcgccccgc
aaagctgtaccacgcacgagcatggcatttgttggccaaaagtcagaagaaaaaagagcc
gacctaatcgcctatcttgaaacgctgaaatag

DBGET integrated database retrieval system