KEGG   Helicobacter bizzozeronii: HBZC1_01740Help
Entry
HBZC1_01740       CDS       T01540                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HBZC1_01740
Enzymes [BR:hbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HBZC1_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156608..157285)
Genome map
AA seq 225 aa AA seqDB search
MGDRPIVLVGSKLHASLGFEQLVVSAIEYLPIRLDLAPIKALIFTSKHAPLALEHQFKNT
PTESILKSLPIFALASKSAQVARDLGFNVYFVGQKGEGLGFCAEMSPLLRPLLPPNSYAL
YVRAQTIVSNLDQALIQAQIPLKQCTAYQVKPLKLPPERKPKLRSILIFGAPSAYKAFRA
NFDWDRSYTAIALGESTLKSFDPQMSAFKSPKPTLESSIALAKTL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgatcgccccatcgtgctggtgggctctaaactccatgcgagtttggggtttgaa
caacttgttgtgagtgccatcgagtatttgcctataaggcttgatctagcccccatcaaa
gccttaattttcacctccaagcacgcccccctagccctagaacaccagtttaaaaacacc
cccacagagtccatcttaaagagtctccctatctttgccctagcctctaagagcgcacaa
gtggcgcgcgatttgggctttaatgtgtattttgtcgggcaaaagggggagggtttgggc
ttttgtgctgagatgagtccccttttgcgccccctcttgccccccaactcttatgccctc
tatgtgcgcgcacaaaccattgtttctaatttggatcaagccctcatccaagcacaaatc
cccctcaaacaatgcaccgcctaccaagtaaaacccctcaaactcccccccgagcgcaaa
cccaagctccgctccattttgatctttggcgcacccagtgcctacaaggcttttagggct
aattttgattgggatcggagttatacagccatcgccctaggggagagcaccttaaaaagc
tttgatccccaaatgagtgcatttaaaagccccaaacccactttagaatctagcatcgcc
ttagcaaaaacactctga

DBGET integrated database retrieval system