KEGG   Helicobacter bizzozeronii: HBZC1_01810Help
Entry
HBZC1_01810       CDS       T01540                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HBZC1_01810
Enzymes [BR:hbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HBZC1_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164431..165054)
Genome map
AA seq 207 aa AA seqDB search
MNVYVREVDQKLLEHLQRVSLSMFRKGFFSIFRGSISARLSPTRFIINKQNAVFDSLDEE
SFIVLQDKLDYRWQESSMDTPIHANLYKYFTEARFIAYARPPHAIAYSLNHEDLKPKDYL
GYSMLGNKIEIYDPKNYKDWQDRAPVDILHYLQESKRRFIFIKGCGIVVYHRELQSLLKV
LDLIEGSCQVLQLANMTDYETDERFNV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtctatgtgcgtgaagtggatcaaaaattactcgaacatttgcagagggtttcg
ctttcgatgttccgtaagggcttttttagcatttttaggggctctatttcagcccgtctg
agcccgacgcgttttatcatcaacaaacaaaatgccgtctttgatagtttggacgaagaa
tcttttattgttctacaagataagcttgattaccgctggcaagaatccagcatggacact
cccatacacgccaatctttacaaatattttacagaagcacgctttattgcttatgcccgc
cccccccatgccattgcctattcgctcaaccatgaagacttaaagcctaaggactatttg
ggttactccatgctggggaataaaattgagatttacgatcccaaaaattataaggattgg
caagatcgcgccccagtggatattttgcattacttgcaagagagcaagcggcgttttatt
ttcattaagggctgtgggattgtggtctatcaccgcgaattacaaagtttgctcaaagtt
ctggatctcatcgaggggagttgccaagtcctgcaacttgccaacatgacagattatgaa
accgatgagaggtttaatgtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system