KEGG   Helicobacter bizzozeronii: HBZC1_01890Help
Entry
HBZC1_01890       CDS       T01540                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBZC1_01890
   01230 Biosynthesis of amino acids
    HBZC1_01890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBZC1_01890
   00051 Fructose and mannose metabolism
    HBZC1_01890
   00562 Inositol phosphate metabolism
    HBZC1_01890
Enzymes [BR:hbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HBZC1_01890
Exosome [BR:hbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HBZC1_01890
  Exosomal proteins of bladder cancer cells
   HBZC1_01890
  Exosomal proteins of melanoma cells
   HBZC1_01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(170749..171474)
Genome map
AA seq 241 aa AA seqDB search
MKYVLANFKSYAIDLLPYLECLGSALDAKLAPYVTLFPPILELGQVQHAYTHFSLGAQNA
YPALDGAFTGEVTLQALQKRHIKSVLIGHSERRLLESDSFCAEKFHFFKSHHFQIIFCIG
ESLQLREQGEKALVAHLLNQLEGIDLDYPKLIVAYEPIWAIGTGVSAQSSDIASTLSALK
VALRQAGHTIPLMVYGGSVQASNATEILDLAEVDGVLVGKACLDLDSLLEIIKISAGKEL
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtatgttttggctaatttcaaatcttatgcgatcgatttgttgccctatttagag
tgcctaggtagtgctttggatgccaagctagctccctatgtaacgcttttcccccccatt
ttagaattagggcaagtccagcatgcatatacgcatttttctttgggggcacaaaatgcc
taccccgccctagatggggcattcactggcgaggttaccctgcaagccctgcaaaaaaga
cacattaaaagcgtgctcatcgggcatagtgagaggcgtttgttagagagcgattctttt
tgtgcagaaaaattccacttttttaaatcccaccatttccaaatcatcttttgcatcggc
gagtccttgcaactaagagaacaaggagaaaaggcactggtggcgcacttgttaaaccag
cttgaggggattgacctagattaccccaaactcatcgtggcttacgagcccatttgggcg
attggcacgggggtgagtgcacagagtagcgatattgccagcactttaagtgcactcaag
gtagctttacgccaagcaggacataccattcctttaatggtttatggcgggagtgtgcag
gcgagcaatgccacagagattttagatttagcagaggtagatggcgtgctggtgggtaag
gcgtgtttggatttagattccttgttagagatcattaaaattagtgctggtaaggagtta
gtatga

DBGET integrated database retrieval system