KEGG   Helicobacter bizzozeronii: HBZC1_02860Help
Entry
HBZC1_02860       CDS       T01540                                 

Definition
diaminopimelate epimerase (EC:5.1.1.7)
Orthology
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBZC1_02860
  Amino acid metabolism
   00300 Lysine biosynthesis
    HBZC1_02860
Enzymes [BR:hbi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     HBZC1_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265945..266712
Genome map
AA seq 255 aa AA seqDB search
MIFHKYCASGNDFLIAHHFTKQDRSNLAKELCNRHSGFGADGLVILLPHSSHAYEWEFYN
ADGSVASMCGNASRCVAFYAYMQGLAPLQHSFISSSKAISVEIQELQGQQALVQSNLGHY
TWLQSLELEGQAWHLIDTGVPHLVHFVDHPSQIPTHKTPQMQDLRTRFNANVNFAYIQDS
HTIKLATYERGVEDITLACGTGMAAVFIAAHLKHRTLDQAVLIPPSGQHLSLHVCHDEIY
FKGWVQFVGVVYPYR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattttccataaatattgcgccagtgggaatgattttttgatcgcccaccattttacc
aagcaggatcgatccaacttggctaaggagctttgtaatcgccattctggttttggggca
gatggtttggtgattttattgccccactctagccatgcctatgaatgggagttttataat
gccgatgggagcgtggctagcatgtgtgggaatgcgagtcggtgcgtggcgttttatgcc
tacatgcagggtttagcccccttgcaacactcttttatcagcagttctaaagccattagc
gtagaaatccaagaattacaagggcaacaagccttggtgcaaagcaatttggggcattat
acatggcttcagagcttggagctagaggggcaagcttggcatttaatcgatacaggcgtg
ccccacttggtgcattttgtggatcaccctagccaaatccccacgcacaagacccctcag
atgcaagatttacgcacacgctttaatgccaatgtcaattttgcctatatccaagattcc
catacaatcaaactcgccacttatgaaaggggcgttgaggacatcactttggcatgcggg
acgggcatggcagcggtgtttattgccgcccatctcaagcaccgcactttggatcaagcc
gtgttgatcccccccagtgggcaacatttatccttgcatgtgtgccatgatgaaatttat
tttaaaggctgggtgcaatttgttggggtggtgtatccataccgctaa

DBGET integrated database retrieval system