KEGG   Helicobacter bizzozeronii: HBZC1_02860Help
Entry
HBZC1_02860       CDS       T01540                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00300  Lysine biosynthesis
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
hbi01120  Microbial metabolism in diverse environments
hbi01130  Biosynthesis of antibiotics
hbi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HBZC1_02860
Enzymes [BR:hbi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     HBZC1_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: CCB79272
UniProt: F8KR98
Position
265945..266712
Genome map
AA seq 255 aa AA seqDB search
MIFHKYCASGNDFLIAHHFTKQDRSNLAKELCNRHSGFGADGLVILLPHSSHAYEWEFYN
ADGSVASMCGNASRCVAFYAYMQGLAPLQHSFISSSKAISVEIQELQGQQALVQSNLGHY
TWLQSLELEGQAWHLIDTGVPHLVHFVDHPSQIPTHKTPQMQDLRTRFNANVNFAYIQDS
HTIKLATYERGVEDITLACGTGMAAVFIAAHLKHRTLDQAVLIPPSGQHLSLHVCHDEIY
FKGWVQFVGVVYPYR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattttccataaatattgcgccagtgggaatgattttttgatcgcccaccattttacc
aagcaggatcgatccaacttggctaaggagctttgtaatcgccattctggttttggggca
gatggtttggtgattttattgccccactctagccatgcctatgaatgggagttttataat
gccgatgggagcgtggctagcatgtgtgggaatgcgagtcggtgcgtggcgttttatgcc
tacatgcagggtttagcccccttgcaacactcttttatcagcagttctaaagccattagc
gtagaaatccaagaattacaagggcaacaagccttggtgcaaagcaatttggggcattat
acatggcttcagagcttggagctagaggggcaagcttggcatttaatcgatacaggcgtg
ccccacttggtgcattttgtggatcaccctagccaaatccccacgcacaagacccctcag
atgcaagatttacgcacacgctttaatgccaatgtcaattttgcctatatccaagattcc
catacaatcaaactcgccacttatgaaaggggcgttgaggacatcactttggcatgcggg
acgggcatggcagcggtgtttattgccgcccatctcaagcaccgcactttggatcaagcc
gtgttgatcccccccagtgggcaacatttatccttgcatgtgtgccatgatgaaatttat
tttaaaggctgggtgcaatttgttggggtggtgtatccataccgctaa

DBGET integrated database retrieval system