KEGG   Helicobacter bizzozeronii: HBZC1_03110Help
Entry
HBZC1_03110       CDS       T01540                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HBZC1_03110
Enzymes [BR:hbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HBZC1_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(289130..289681)
Genome map
AA seq 183 aa AA seqDB search
MCDLEQLLNKWFASIGENPQREGLKDTPKRLEKLWGDLMAGYKSNPQEILQGGFDTCGCE
GLVVLKNMEFYSLCEHHLLPFFGHISLGYIPNEKIVGLGAIARLVECFSRRLQIQERLST
QIADTFNQIVHPKGVAVVCSAKHLCMAMQGVQQQDSTIKTSVLRGIFKEDTHTRAEFMEL
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatttagaacaactcttaaataaatggtttgctagcataggcgagaatccgcaa
cgcgaggggctcaaagacacacccaaaaggcttgaaaagctttggggggacttgatggca
ggctataaaagcaatccacaagagattttacaaggtgggtttgatacatgcgggtgcgag
ggcttggtggtgcttaaaaacatggagttttatagcctgtgtgagcaccatttattgccc
ttttttgggcatattagcttgggttatatccccaatgaaaagatcgtgggtttgggcgcg
atcgcgcgcttggtggagtgcttttctaggcgtttgcaaatccaagaacgcctaagcacg
cagattgccgacacctttaatcagattgtgcaccctaagggcgtggcggtggtttgtagt
gctaaacatctttgcatggcgatgcagggcgtgcaacaacaagatagcacgatcaaaacc
agtgttctaagggggatctttaaagaggatacacacacaagggcggagtttatggagttg
ttgcgttcttag

DBGET integrated database retrieval system