KEGG   Helicobacter bizzozeronii: HBZC1_03110Help
Entry
HBZC1_03110       CDS       T01540                                 

Definition
(GenBank) GTP cyclohydrolase I type 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00790  Folate biosynthesis
hbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HBZC1_03110
Enzymes [BR:hbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HBZC1_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: CCB79297
UniProt: F8KRC3
Position
complement(289130..289681)
Genome map
AA seq 183 aa AA seqDB search
MCDLEQLLNKWFASIGENPQREGLKDTPKRLEKLWGDLMAGYKSNPQEILQGGFDTCGCE
GLVVLKNMEFYSLCEHHLLPFFGHISLGYIPNEKIVGLGAIARLVECFSRRLQIQERLST
QIADTFNQIVHPKGVAVVCSAKHLCMAMQGVQQQDSTIKTSVLRGIFKEDTHTRAEFMEL
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatttagaacaactcttaaataaatggtttgctagcataggcgagaatccgcaa
cgcgaggggctcaaagacacacccaaaaggcttgaaaagctttggggggacttgatggca
ggctataaaagcaatccacaagagattttacaaggtgggtttgatacatgcgggtgcgag
ggcttggtggtgcttaaaaacatggagttttatagcctgtgtgagcaccatttattgccc
ttttttgggcatattagcttgggttatatccccaatgaaaagatcgtgggtttgggcgcg
atcgcgcgcttggtggagtgcttttctaggcgtttgcaaatccaagaacgcctaagcacg
cagattgccgacacctttaatcagattgtgcaccctaagggcgtggcggtggtttgtagt
gctaaacatctttgcatggcgatgcagggcgtgcaacaacaagatagcacgatcaaaacc
agtgttctaagggggatctttaaagaggatacacacacaagggcggagtttatggagttg
ttgcgttcttag

DBGET integrated database retrieval system