KEGG   Helicobacter bizzozeronii: HBZC1_03160Help
Entry
HBZC1_03160       CDS       T01540                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hbi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294067..295227
Genome map
AA seq 386 aa AA seqDB search
MDHFIMALDQGTTSSRTLIFDKQGRVVSMAQKTFSQFFPKPGWVEHDPKEIWATQIATLT
EALAKANLDAKNIAALGITNQRETTVLWDRHTGEPIYNAIVWQDHRTADVCEELKKTHKE
MIQAKTGLVIDAYFSATKIAWILDHVKGARQKAQQGDLCFGTIDTWLLYNLTKRRVHFTD
PSNASRTMLFNIHTLEWDKQLLALFNIPKEILPEVKSSSEIYGHTATRWVEREIPIAGMA
GDQQAALFGQMCIEPGMVKNTYGTGCFLLMQTGQQSVASQNNLLSTIAWKIGGKVSYALE
GGVFVGGAAIQWLRDGARMIRTAPDIQNLASTVEDNGGVYVVPALTGLGAPYWDHICPGE
YLWDQPWEHRWAHCARHFRGDRLPSA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggatcattttatcatggcactcgatcaaggcacgacctcatcacgcaccctcattttt
gacaaacaagggcgggtggtctcgatggcgcaaaaaacctttagccaatttttccccaaa
cccggttgggtcgaacacgatcccaaagaaatttgggcgacccagatcgccacgctcacc
gaggctttggctaaggctaatttagatgctaaaaatatcgccgctttggggatcaccaac
caaagagaaaccacggttttatgggatcgccacacgggcgagcctatttataatgccatt
gtgtggcaggatcaccgcaccgccgatgtgtgcgaagaactcaaaaagacccacaaagag
atgatccaagccaaaacggggctagtcattgatgcctatttttcagccaccaagatcgca
tggattttagaccatgtcaagggagccagacaaaaagcccagcaaggcgatctgtgcttt
ggcacgatcgatacttggttgctctacaacctcaccaaaaggcgggtgcattttaccgat
cccagtaatgccagccgcaccatgctttttaatatccacaccctagagtgggataagcaa
cttttagccctctttaacatccctaaagaaattctacctgaggtcaaatcctctagcgag
atttacgggcacaccgccacgcgttgggtggagcgtgaaatccctatcgctgggatggct
ggcgatcaacaagccgccttgttcgggcaaatgtgcattgagccgggcatggtcaaaaac
acctatgggacggggtgctttttactcatgcaaaccgggcaacaaagcgtggctagccaa
aataatttactgagcaccattgcatggaaaattgggggcaaagtgagctatgccctagag
gggggcgtgtttgtaggcggggcggcgatccagtggttaagagatggggctagaatgatc
cgcacagccccagacatccaaaatttggctagcacggtggaagataatggcggggtgtat
gttgtgccggctttaacgggtctaggcgcaccttactgggatcacatatgcccgggggag
tatctttgggatcagccgtgggagcaccgatgggcacattgcgcgcgccattttagaggg
gatcgccttccaagtgcatga

DBGET integrated database retrieval system