KEGG   Helicobacter bizzozeronii: HBZC1_03670Help
Entry
HBZC1_03670       CDS       T01540                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBZC1_03670
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HBZC1_03670
Enzymes [BR:hbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HBZC1_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338540..339217
Genome map
AA seq 225 aa AA seqDB search
MPIKTLQAYLELKKSLTPFELLGRSLAYNPYVPRLALEDLKRPPSQEIAHSILYLDAGWD
LEFLLEKLSQADKARALLLDFTPLYIQGMPALEALDLLGYIRRLSPKPLIHKDYFVSQYQ
ILESLVHGADALLLNASLLAKNLKEILEYSARLGLLGIVQVATPKELKTSILAKAPALYF
PQNFNTLLELTPQRPLIFKDLDDLAPNAQNSYGADGLVIKLSKQT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataaaaaccctccaagcctacctagagctcaaaaaatccctaaccccctttgaa
cttttgggtaggagtctagcctataacccctatgtccccagactcgccttagaggattta
aaacgccccccctcccaagagatcgcccactccattttatatcttgatgctggctgggat
ttggaatttttattagaaaaacttagtcaagcagacaaggcgcgtgcccttttactggat
tttacccccctctacatacaaggcatgcccgccctagaagcgctggacttactgggctat
atacgccgcttgagccctaagcccttaattcacaaagattattttgtgagccagtatcaa
atcttagagtccttagtgcatggggctgatgcgctcttgctcaacgcctctttgttggca
aaaaacctcaaggagatattagagtatagcgcacgcttggggttgcttggcattgtgcag
gtggctactcctaaagaactcaagacaagcattctagccaaagccccagccctctacttc
ccccaaaattttaacaccctcctagagctcaccccccaaagacccctgattttcaaagac
ctagacgatctagcccccaatgcccaaaactcctatggtgcggacggactggtgatcaaa
ctttcaaagcaaacttaa

DBGET integrated database retrieval system