KEGG   Helicobacter bizzozeronii: HBZC1_04010Help
Entry
HBZC1_04010       CDS       T01540                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hbi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(369971..371119)
Genome map
AA seq 382 aa AA seqDB search
MPYTFCCYFSQQMSSILILGSTGSIGMQALKVAQRFNLKIEGLSAGRNIPLLNAQIKTHQ
PSQVAILDPSDRSLLQVPQGVEVFVGTQGICEMIACSQASLVLNAIVGFGGLAPTLSVLQ
HHKKLALANKESLVVAGWLLDTKQILPIDSEHFGLWALLQKHPLEHVQMLYLTASGGALR
DVPLSDIPTQSLEKVLQHPNWQMGAPITINSANMVNKLFEVLEAYWLFGLTNIDAYIERT
SSVHALIRFKDHSVHAQLSSPNMQLPIAHALMPSLACQTPLIEPLDLLSLPPLRFEPIDT
ARYPLWALKNTLLAHPKLGVVLNASNEVALQAFRAKKIAFGQMANLIFQTLERFEKDTPK
LHTLEDILALDQEVRGFCTKLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgccctacactttttgttgttattttagccaacaaatgtcctctattctgattttaggg
agcacgggctctattggcatgcaagcccttaaggtggcgcaacgctttaatcttaaaatc
gagggcttgagtgcggggcgtaacataccccttttaaacgcccaaatcaaaacccaccag
cccagccaagtggcgatcttagaccctagcgatcgatctttattgcaagtgccccaaggg
gttgaggtctttgtaggcactcaagggatttgtgaaatgatcgcttgctcccaagccagc
cttgtattaaatgcaattgtgggctttggggggttagcccccactctaagcgtgctccaa
caccacaaaaaattagccctagccaataaagagtccctagtggtggcaggctggctttta
gacaccaaacagattttacccattgatagcgaacattttggcttgtgggcgttattgcaa
aagcaccccttagagcatgtccaaatgctgtatttgaccgccagcgggggggctttacgc
gatgtgccactctctgatattcccacccaaagcctagaaaaggtcttgcaacaccccaac
tggcaaatgggcgcgcccatcacaatcaattcagccaatatggttaataagctttttgaa
gtgctggaagcctattggctttttggactgactaacattgatgcctatattgagcgcacc
tctagcgtgcatgcccttattcgctttaaagatcacagcgtgcatgcccaactctctagc
cccaatatgcaactccccatcgcccacgcactcatgccctctttggcttgccaaaccccc
ctaattgagcccctagacttactcagcctaccccccctgagatttgagcccattgacaca
gcgcgctaccccctatgggcactcaaaaacacgcttttagcacaccccaagctaggcgtg
gtgctcaatgccagcaatgaagtcgccttgcaagcctttagggcaaaaaagatcgccttt
gggcagatggctaatctcatattccaaaccctagagcgctttgagaaagacaccccaaag
ctacacaccctagaggacattttagccctagatcaagaagtgcgggggttttgcacaaaa
cttttctag

DBGET integrated database retrieval system