KEGG   Helicobacter bizzozeronii: HBZC1_05170Help
Entry
HBZC1_05170       CDS       T01540                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HBZC1_05170
   00052 Galactose metabolism
    HBZC1_05170
   00500 Starch and sucrose metabolism
    HBZC1_05170
   00520 Amino sugar and nucleotide sugar metabolism
    HBZC1_05170
Enzymes [BR:hbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HBZC1_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488139..488969
Genome map
AA seq 276 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPIANKPLIQYGVEEAMEAGCDTMAIVTGRGKR
AIEDHFDISYELEHQINGTHKEQSLAGIRTIMQTCRFSYTRQHEMKGLGHAIHTAQTLIG
NEPFCVILADDLCVNAPGFGVLRQMVDLYAKYQCCIVAIEEVALEEVHQYGVICGQEIAN
GVYQVKDMVEKPKPEEAPSNLAVIGRYILTPDIFEVLKNTPPGKNNEIQITDALLQQAQS
KLVLAYKFQGKRYDCGNMHGFVQATNDFYHLYAQSH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgccttttccctgctgctgggtatggcacgcgctttttacccgccaca
aaggcgatgcctaaagaaatgctccccattgccaataagcccttgatccaatatggcgtg
gaggaggcgatggaggcgggttgcgacacaatggcaattgtaaccgggcggggcaagcgc
gccattgaagatcattttgatattagctacgaattagagcaccaaatcaatgggacccac
aaagagcaatctttagccgggattcgcaccatcatgcagacttgccgtttttcctacacc
cgccaacatgagatgaaaggattagggcatgccatccacaccgcccaaaccttgattggc
aatgagcccttttgtgtgatcttagctgatgatctgtgtgtcaatgcaccgggctttggg
gttttacgccaaatggtggatttatatgccaaataccaatgttgcattgttgccattgag
gaagtggcactagaggaggtgcaccaatacggcgtgatttgtgggcaagaaattgccaac
ggggtttatcaagtaaaagacatggtcgaaaagcccaagcctgaggaagccccaagcaat
ctagccgtgatcgggcgttatatcttaacccccgatatttttgaggtgctcaaaaacacc
cccccgggcaaaaataacgaaatccaaatcacagatgcgctcttgcaacaagcccaaagt
aagctagttctagcttacaagtttcagggcaagcgttatgattgtgggaacatgcacggc
ttcgtgcaagcgactaacgatttttaccacctctacgcgcaatcccattag

DBGET integrated database retrieval system