KEGG   Helicobacter bizzozeronii: HBZC1_05190Help
Entry
HBZC1_05190       CDS       T01540                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hbi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hbi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489380..490660
Genome map
AA seq 426 aa AA seqDB search
MDYLEIKGQEPLKGSVPISGAKNAALPILASTLLEQESVAISGLPAVADVRALVELLEHL
GVQTQWHTPNSLEIRTTSLNCSTERCTAPYDIVRKMRASILVLGPLLARFGSCAVSLPGG
CAIGARPVDLHLKALEKMGAHIHIEKGYIIAKAKHGLKGCDIILDKITVTGTENILMAAS
LAKGETKIINAAKEPEVVQLCHFLQSAGVEISGVGSSELCIQGTQGQALHFKPIHIIPDR
IECGTYLCAAAITNSTLTLSNTNAHHLEAILSKLNEIGFKIDIAEDTLTIHKARTRKGFE
IITTEYPGFPTDLQAQFMALATQCEGNSLIEERLFENRFMHVSELQRMGADISLKGALAK
INGGCALMGADVMATDLRASSALILAALVAKGKSRVHRIYHLDRGYESLELKMNALGAKI
KRLKEK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttggactacttagagatcaaaggacaagagcctttaaaagggagcgtgcctatctcgggg
gctaaaaatgccgctttgcccattttggctagcacacttttagaacaagagagcgtggcg
atcagcggtttgcccgctgtggctgatgtgcgcgcgttggttgagcttttagaacatttg
ggggtgcaaacccaatggcacacacctaacagccttgaaatccgcaccacgagtttaaat
tgcagcacagagcgttgcaccgccccttatgacattgtgcgtaaaatgcgcgcctctatt
ttggtgctaggaccgctattagcgcgctttggctcgtgtgcggtgagtttgcccgggggg
tgtgccattggggctagacccgtggatttgcacctaaaagccttagaaaaaatgggggcg
catatccacattgaaaagggctatatcatcgctaaagccaagcacggactcaagggctgt
gatattattttagacaagatcaccgttacgggcacggaaaatatcctcatggcggccagc
ttggcaaagggggaaaccaagatcatcaatgcggctaaagaacccgaagtggtgcagtta
tgccactttttgcaaagtgctggggtggagattagcggggtgggcagttctgaattatgc
atccaaggcacgcaagggcaagccctgcactttaaacccatccacatcattcccgatcgc
atcgaatgcgggacttatttatgcgcagcagcgatcaccaactccacactcactctaagc
aacaccaacgcccaccacttggaggcaattttaagcaagttaaacgaaattggctttaag
atcgacattgcagaagacacgctcaccatccacaaagcgcgcacccgcaagggctttgag
atcatcaccaccgaatacccgggtttccctactgatttgcaagcccaattcatggcatta
gcgacccagtgtgaggggaatagcctcattgaagagcgtttgtttgaaaaccggtttatg
catgtgagcgaattgcaacgcatgggggctgatattagcttaaaaggggcactggccaag
atcaatgggggttgtgccctaatgggggcagatgtaatggcaaccgatttaagggcttcc
tcagccctcattttagccgctttggtggctaagggcaaaagtcgggtgcaccgcatttac
cacttggatcgcgggtatgagagtttggagctcaagatgaacgccttgggggccaaaatc
aaacgcttaaaagagaaatga

DBGET integrated database retrieval system