KEGG   Helicobacter bizzozeronii: HBZC1_05570Help
Entry
HBZC1_05570       CDS       T01540                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hbi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(528307..529278)
Genome map
AA seq 323 aa AA seqDB search
MFRRLRRLRATENLRALVRETRLHVADFIAPLFVLEGVGVSNPIASMPGVFQMSIDMILK
ECALLQDLGIQAVLLFGIPSHKDAQGSSALNADHIVAKATRAIKKELPSLVVIADLCFCE
YTDHGHCGILRDQSVDNDKTLEILGKQAVILAQSGVDVIAPSAMMDGMVLAIRQALDQGG
YPHTPIMSYSTKFASSYYGPFRDVAQSAPSFGDRKSYQMDYANPKEAILESLEDEIQGAD
ILMVKPALVYLDIVRSIKDRTLLPLALYNVSGEYAMFKLAQAHNLMDYDRLLLETMIAFK
RAGADMIISYHAKEVAQLLQKGF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtttagacgcttaagacgcttgcgtgccacagaaaatttacgggctttggtgcgtgaa
acaagactgcatgttgctgattttatcgcgcctttatttgtgcttgagggggtgggggtg
tctaaccccattgcctccatgcccggggtgttccaaatgagtattgatatgatcttaaaa
gaatgcgccttgttgcaagatttgggcattcaagccgtgctgttatttggaatccccagc
cacaaggacgctcaaggctcaagtgcgcttaatgccgatcatatagtggctaaagccacg
cgtgccattaaaaaagagttgccctctttggtggtgattgctgatctgtgtttttgtgaa
tacaccgatcacgggcattgtggcattttgcgcgatcaaagcgtggataatgacaaaacc
ctagagattttgggcaagcaggctgttatcctagcccaaagtggggtggatgtgatcgcc
cctagtgcgatgatggatggcatggttttagcgattcgccaagccttggatcaagggggc
tacccccacacaccgatcatgagctactccactaagtttgccagtagctattatggtccc
tttagagatgtggcgcaatctgcccccagttttggggatcgcaagagttaccaaatggat
tatgccaaccccaaagaggcgatcttagagagtttagaagatgagattcaaggggcagat
attttgatggtcaagcccgctttggtgtatttggatattgtgcgtagcattaaggatcgc
acgctcttaccccttgctctttacaatgtgagcggggaatatgcgatgttcaaactcgcc
caagcccataatttaatggattatgatcgcttgcttttagaaaccatgatcgcttttaag
cgtgcgggggcggatatgatcatcagctaccacgctaaagaagtggcacaactcttacag
aaaggattttaa

DBGET integrated database retrieval system