KEGG   Helicobacter bizzozeronii: HBZC1_05710Help
Entry
HBZC1_05710       CDS       T01540                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(540413..540847)
Genome map
AA seq 144 aa AA seqDB search
MWDLKNTATLGIGSNVGDSKKIFEWLWLWFARHRAFSLLTSSPLYLNPPFGYHHQAHFYN
ATLSFKTALSVLELFSLIFYLERRWGRSRKRAFKNAPRTLDIDVIFFNRLVSRQAHRMLP
HPEWSRRESVLVPLILGHLAWRES
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggatttgaagaatacagcaacgctgggcatagggagcaatgtgggcgattctaaa
aagatttttgagtggctttggttgtggtttgctagacaccgcgctttttctttattgacc
tcttcacccctctatctcaacccgccctttggttaccaccaccaagcccatttttacaac
gcaaccctttcttttaaaaccgcattgagcgtcctagaattattcagcctcatcttttac
ttagagagacgctgggggcgtagccgtaagcgtgcctttaaaaatgcgccccgcaccctt
gatattgatgtgattttttttaaccgcctcgtatctaggcaagcacaccgcatgttaccc
caccctgagtggagtcggcgtgaatcggttcttgtgcccttgatcttggggcatttggct
tggagagaatcatga

DBGET integrated database retrieval system