KEGG   Helicobacter bizzozeronii: HBZC1_05800Help
Entry
HBZC1_05800       CDS       T01540                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hbi  Helicobacter bizzozeronii
Brite
Enzymes [BR:hbi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HBZC1_05800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549706..550821
Genome map
AA seq 371 aa AA seqDB search
MFQKSRILSGVLVGALAVAGLGAKNNTQADFALIKRALGANLVPMPQGKDLQKYLIKKVT
DLGLSYKGPVMTKAQIELGKKLYLDPRISTSYLISCNTCHNLGLAGVDLVSRAVGEGWKP
NPHFLNSPTVYNSVFNSVQFWDGRAAHLGDQAKGPISNPVEMNADPKVVEAKINSMPGYV
KAFKRAYGNHVKIDLNLITDTIAMFEATLNTPSRYDDFLRGNVKALSPQEKEGLKLFLDK
GCIACHNGINLGGTMQPFQVAAPYKFANVGDFKGNKDGMVKVPTLRNILETMPYFHNGQY
WDVKDAIKEMGAIQLGITINDEEAKKIETFFGALTGKKPTIVYPDLPAITATTPKPEGIM
ESDTQPKAPSH
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaaaaagtcgtattttgtctggtgtgttggtgggggcgttggctgtggcaggc
ttgggcgctaaaaacaacacccaagcggattttgccttgatcaaacgggcattaggggct
aatttagtgcccatgccccaaggtaaggatttgcaaaaatatttaatcaaaaaggttact
gatttggggctctcttataaaggtcctgtgatgactaaggcgcaaattgaattgggtaag
aaactttatttagaccctagaatctccacctcctatttgatctcttgtaacacctgccat
aatttggggttagcgggtgtggatttagtttctagggcggtgggtgagggctggaaaccc
aacccgcattttctcaattcgcccaccgtgtataactctgtctttaactcggtgcagttt
tgggatgggcgtgcggcacacttgggcgatcaagctaaagggcctattagcaatcctgtt
gaaatgaatgccgatcctaaagtggtggaggctaagatcaattctatgcccgggtatgtc
aaagcctttaaacgggcttatggcaaccatgtcaagatcgatcttaacctcatcaccgat
accattgccatgtttgaagccactttgaacacgcctagccgttatgatgatttcttaagg
ggcaatgtcaaagccctaagtccacaagaaaaagagggcttgaaactctttttagacaag
ggctgtattgcctgccataatggaatcaatctaggggggacaatgcaacctttccaagtg
gcagcaccttacaagtttgccaatgtgggcgattttaaggggaataaagatggcatggtc
aaagtgcccactttacgcaatatcctagaaactatgccctatttccacaacgggcagtat
tgggatgtcaaggatgcgattaaagagatgggggcaatccagttaggcatcacgatcaat
gatgaagaggctaaaaagattgaaactttctttggtgcgctcacgggcaaaaaacccacc
atcgtttatcccgatctacccgctatcacagcgaccacacctaaacccgaagggatcatg
gaaagcgatacccagcctaaagctccttcgcattag

DBGET integrated database retrieval system