KEGG   Helicobacter bizzozeronii: HBZC1_07650Help
Entry
HBZC1_07650       CDS       T01540                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HBZC1_07650
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HBZC1_07650
Enzymes [BR:hbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HBZC1_07650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(721398..722717)
Genome map
AA seq 439 aa AA seqDB search
MKLAKEIDACGRIFSAISDDTRDLGDPHCLLLKTPSNQAFVQAHLEKFPNTPYIHAPELK
NHFDLGLKIIGITGTNGKTTTASLIYSLLLDLGYSCALLGTRGFFCNDQRLKPKGLTTPP
LLELYSDIERAKQEGAGYFVMEVSSHAIAQERILGLEFSAKVITNITSDHLDYHKNLDTY
RQVKNAFLQDTGLKVINRDDPHVRFNPTNAYGYGIEAKSHLSVSAYSLLPNLSAHVEFWE
NPSLRYRSPKKCAHEACLLHSPLMGLHNLYNLLGGLLCVKLLTKQSLESLSTLAQNFLGV
QGRMEVVHSKPLVIVDFAHTADGFEQIFNSFKGHKIKALFGAGGNRDKSKRPLMGAIASQ
HAMQVYITSDNPRDEDPLTIMQEILAGVPEHKCAQVILEVDRKRAIILALEALKSDEVLL
ILGKGDESVQIIEGSKPPL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccaaagaaattgatgcttgcgggcggatctttagtgctattagcgatgat
acccgtgatttgggcgatccacattgcttgttgcttaaaacccctagtaatcaagccttc
gtacaagcccacttagaaaaattccccaacacgccctatatccatgctccagagttgaaa
aatcattttgatttggggcttaaaatcattgggatcacgggcaccaatggcaaaaccaca
actgcgagcctcatttattccttgctgttggatttgggctactcttgtgcgttgctgggc
acaagggggtttttttgcaacgatcaacgcctaaagcctaaaggactgaccacaccccca
cttttggaactttatagcgatattgaacgcgccaagcaagagggggcaggttattttgtg
atggaggttagttcacatgcgatcgctcaggagcgcattttggggctagagtttagtgcc
aaagtgatcaccaatatcactagcgatcaccttgactaccacaagaacctagacacctac
cgccaagttaaaaacgccttcttgcaagatacgggcttaaaagtcattaaccgcgatgat
ccccatgtgcgttttaaccccacaaacgcctatggctatggcattgaagccaaaagccac
ttgagcgtgagcgcgtattctttattgcccaatttgagcgcacatgtggagttttgggaa
aatcccagtctgcggtatcgatcgcccaaaaagtgcgcgcatgaggcgtgtttgttgcac
tcccctctaatgggactacataatctttataatctcttgggggggctcttgtgtgtgaaa
cttttaacaaagcagagtttagagagcttaagcacattggcgcaaaatttcttaggtgtg
caggggcgtatggaggtggtgcattctaagcctttggtgattgtggattttgcccacacc
gccgatgggtttgaacagatttttaatagctttaaggggcacaagatcaaggcacttttt
ggggcggggggtaatcgcgataaaagcaaacgccccttaatgggtgcaattgctagccaa
catgccatgcaggtttatatcacttcagataaccctagagatgaagaccccctaacaatc
atgcaagagattttagccggtgtccctgagcacaagtgcgcccaagtgatcttagaggtg
gatcgtaaaagggcgattattctagcccttgaggcactcaaaagcgatgaggtgctgttg
attttgggtaagggcgatgagagtgtgcagatcattgagggatcaaaacctcccctttga

DBGET integrated database retrieval system