KEGG   Helicobacter bizzozeronii: HBZC1_09080Help
Entry
HBZC1_09080       CDS       T01540                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HBZC1_09080
Enzymes [BR:hbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HBZC1_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863495..864286
Genome map
AA seq 263 aa AA seqDB search
MSPFSFEVYPKINVFLKILGLHGGYHTLISRLVLVKNTFKDFISIKTGSAFALKGDFGCA
LQENTIYKMLQALKQHLQAKQAPSSLLKLLDTLHIEVEKHIPTQAGLGGGSANAGMLLAQ
LNQNLNLDLSLPECYAIGAQVGSDVNFFISXFFISGFSSAHVYGRGEWVSPFKESTLEWE
ILTPPMSCQTARVYALFEKTSPFKDMALPSDQLLKKYDRSALNDLLTPALKAYPKLAQFE
KQLPPHWFFSGSGGGFFALKGGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccctttagctttgaggtctatcctaagatcaatgtctttttaaaaatcttgggg
ttgcatggggggtatcacaccttgatttctaggctggtgctggtgaaaaacacctttaag
gattttatatccatcaagaccggatcggcatttgcccttaagggggattttggttgcgct
ttgcaagaaaacaccatttataaaatgctccaagccctaaagcaacacttgcaagccaaa
caagccccctccagccttttaaaactcctagacaccctccatattgaggttgaaaagcac
atccccacccaagcaggcttagggggggggagtgccaatgcgggcatgctcttagcccag
ctcaatcagaatttaaacctagatttgagcctgccggaatgctatgcgatcggggcgcag
gtggggagcgatgtgaatttttttatctcggrtttttttatctcgggtttttctagtgcg
catgtctatggtcggggcgaatgggtcagcccctttaaagagagcaccctagagtgggag
attttaaccccccccatgtcttgccaaaccgctagggtttatgccctctttgaaaagact
agcccttttaaagatatggctttgcccagcgaccaactgctcaaaaaatatgatcgcagt
gccttaaatgatctgctcacccctgcattaaaagcttatcctaagctggcacaatttgaa
aagcaattacccccccattggttttttagcgggagtgggggtggcttttttgcgcttaag
gggggtgcttga

DBGET integrated database retrieval system