KEGG   Helicobacter bizzozeronii: HBZC1_09080Help
Entry
HBZC1_09080       CDS       T01540                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hbi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863495..864286
Genome map
AA seq 263 aa AA seqDB search
MSPFSFEVYPKINVFLKILGLHGGYHTLISRLVLVKNTFKDFISIKTGSAFALKGDFGCA
LQENTIYKMLQALKQHLQAKQAPSSLLKLLDTLHIEVEKHIPTQAGLGGGSANAGMLLAQ
LNQNLNLDLSLPECYAIGAQVGSDVNFFISXFFISGFSSAHVYGRGEWVSPFKESTLEWE
ILTPPMSCQTARVYALFEKTSPFKDMALPSDQLLKKYDRSALNDLLTPALKAYPKLAQFE
KQLPPHWFFSGSGGGFFALKGGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccctttagctttgaggtctatcctaagatcaatgtctttttaaaaatcttgggg
ttgcatggggggtatcacaccttgatttctaggctggtgctggtgaaaaacacctttaag
gattttatatccatcaagaccggatcggcatttgcccttaagggggattttggttgcgct
ttgcaagaaaacaccatttataaaatgctccaagccctaaagcaacacttgcaagccaaa
caagccccctccagccttttaaaactcctagacaccctccatattgaggttgaaaagcac
atccccacccaagcaggcttagggggggggagtgccaatgcgggcatgctcttagcccag
ctcaatcagaatttaaacctagatttgagcctgccggaatgctatgcgatcggggcgcag
gtggggagcgatgtgaatttttttatctcggrtttttttatctcgggtttttctagtgcg
catgtctatggtcggggcgaatgggtcagcccctttaaagagagcaccctagagtgggag
attttaaccccccccatgtcttgccaaaccgctagggtttatgccctctttgaaaagact
agcccttttaaagatatggctttgcccagcgaccaactgctcaaaaaatatgatcgcagt
gccttaaatgatctgctcacccctgcattaaaagcttatcctaagctggcacaatttgaa
aagcaattacccccccattggttttttagcgggagtgggggtggcttttttgcgcttaag
gggggtgcttga

DBGET integrated database retrieval system