KEGG   Helicobacter bizzozeronii: HBZC1_10380Help
Entry
HBZC1_10380       CDS       T01540                                 

Definition
twin-arginine translocation protein TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
hbi  Helicobacter bizzozeronii
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hbi03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:hbi03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
963471..964172
Genome map
AA seq 233 aa AA seqDB search
MLLDDLKPHLQDLRKRLVISIAVLVVAFGLCFHFWQVIFEWIRASYHGKLIQISPIEGIM
VAIKVSFFAALAVSMPVIFWQAWLFIAPGLYKNEKKVVLPFVFFGTLMFVAGASFSYYIV
FPFVINYLSTFGNAVFEANISASSYVSFFTRLILGFGFAFELPVLAFFLAKVGLITDESL
KNYFKYAIVVIFIIAAIITPPDVMSQVLMALPLIGLYGLSILIAKWVNPASKL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgctcctagatgatctcaaaccccatttacaagatttacgcaaacgccttgtgatctcg
attgccgttttggtggtggcttttgggctgtgtttccatttttggcaggtcatttttgag
tggatcagagcgtcttaccatggcaagctcatacagatttccccgattgagggaatcatg
gtggctatcaaggtgagtttttttgccgctttggcggtgtccatgcccgtgatcttttgg
caagcatggctgtttatcgcccccggactttataaaaatgaaaaaaaggtggtcttgccc
tttgttttctttggaactttgatgtttgttgcgggcgcatcattttcctactacattgtc
ttcccctttgtgatcaattacctctctacctttgggaatgcggtttttgaagccaatatc
tccgcttctagttatgtgagcttttttacccgtttgattttgggttttggttttgccttt
gaattgccggtgttggcgtttttcttagccaaagtggggcttatcaccgatgagagtttg
aaaaattacttcaaatatgccattgtggtgatctttatcatcgccgccatcatcaccccc
cccgatgtgatgagtcaagttttaatggcactgcccttaattggactctatgggctctcc
attttgatcgccaaatgggttaatcccgcttccaaactctga

DBGET integrated database retrieval system