KEGG   Helicobacter bizzozeronii: HBZC1_10830Help
Entry
HBZC1_10830       CDS       T01540                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBZC1_10830
  Amino acid metabolism
   00300 Lysine biosynthesis
    HBZC1_10830
Enzymes [BR:hbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HBZC1_10830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002485..1003618
Genome map
AA seq 377 aa AA seqDB search
MNPLNVVWLARELITFKTITPQEEGIFDFIQSLFPGFEVVRADKEGVKNLFLYKRLGACD
NPLHFCFAGHIDVVPAGEGWSVDPFGGVIEDGFLYGRGAQDMKGGVAALLCAVHDFCKQE
NPPNAIISILLTSDEEGEALYGTQYMLEVLQEQNLLPHFALVAEPTSAETLGDSVKIGRR
GSISGQIVVNGICGHVAYPKTCLNPIDLIADKLMLISGALLDKGDDFFAPSKLVITTLKS
VSQASNVTPKTLEIRFNVRNSPLTSAEYIQEFLDTILAKVPCDIELITNSKPFLSSQDSP
LAMQIKRAILETLQITPEFNTKGGTSDARFLRAFGVEVVEFGLLNDRIHALNERVALGDL
EKLQQVFLRLLHLVLKD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccgttaaatgtcgtttggttggctagagagctcatcacttttaaaaccatcacg
ccccaagaggagggcatttttgattttatccaatccttgtttcccgggtttgaggtggtg
cgtgcggacaaggagggggtgaaaaatttatttttatacaaacgattgggggcttgtgat
aaccccttacatttttgttttgccgggcatattgatgtcgtgcctgctggagagggctgg
agtgttgatccctttgggggcgtgattgaggatgggtttttatatgggcggggcgcacag
gacatgaaggggggcgtggcggcactcttgtgtgctgtgcatgatttttgcaagcaagaa
aaccctcctaatgccatcatttctattttgctcaccagcgatgaggagggtgaggcactc
tatggcacccaatacatgctagaggtgctccaagagcaaaatttgttgccccattttgcc
ctagtagcagagcccaccagtgcagaaactttgggcgatagtgtcaaaataggcaggcgg
ggttctattagcgggcaaattgtcgtgaatggcatttgcgggcatgtggcttaccctaaa
acttgtttgaatcccattgatctcatcgctgataaactcatgcttatttcaggagctctt
ttagacaagggagatgatttttttgccccctccaagctagtcatcaccaccctcaaaagt
gtttcacaagccagcaatgtaacgcctaaaactttagaaattcgtttcaatgtccgcaat
tcgcccctcacatctgcagaatacatccaagagtttttagacacaatcttagccaaagtg
ccttgtgatattgagcttatcacaaattccaagccctttttatcctcccaagattcccca
ttggcaatgcaaatcaagcgcgcgatcttagagacactccaaatcacccccgagtttaac
accaaggggggcaccagcgatgcgcgctttttgcgtgcctttggggtggaggtggtggaa
tttggtttgcttaacgatcgcatccatgccctaaatgaacgggtggctttgggcgatttg
gaaaaattacagcaagtttttttaagattactccatttggttttaaaggactaa

DBGET integrated database retrieval system