KEGG   Helicobacter bizzozeronii: HBZC1_13390Help
Entry
HBZC1_13390       CDS       T01540                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00010  Glycolysis / Gluconeogenesis
hbi00052  Galactose metabolism
hbi00500  Starch and sucrose metabolism
hbi00520  Amino sugar and nucleotide sugar metabolism
hbi00521  Streptomycin biosynthesis
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
hbi01120  Microbial metabolism in diverse environments
hbi01130  Biosynthesis of antibiotics
hbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBZC1_13390
   00052 Galactose metabolism
    HBZC1_13390
   00500 Starch and sucrose metabolism
    HBZC1_13390
   00520 Amino sugar and nucleotide sugar metabolism
    HBZC1_13390
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HBZC1_13390
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HBZC1_13390
Enzymes [BR:hbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HBZC1_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CCB80325
UniProt: F8KTZ1
Position
1242882..1243865
Genome map
AA seq 327 aa AA seqDB search
MSSTPPNTYPRLLADIGGTNARFGLERAPGEINSVEVLACHDHHSVVDAIKCYLNKVGNP
SVKLAACAIANPVIGDWVQMTNHHWAFSIETTRQALGFDTLLFINDFAAQAYAIAQLNDD
ELLQVGGTACALHAPKLVIGPGTGLGVSALIPCHNGHYIALSGEGGHVSFAPFDDTEIAI
WKYAKKKYGHVSAERLLSGAGLVLIHAALAEREGIKTAKMTPEIISEQALSGKSPLCRLT
LDIFCTILGTVSSNMALVLGARGGVYLCGGIIPRFIDYFKTSPFRVRFENKGRFDAYLAA
IPVYVVLAKYPGLAGVAIALENHLNKE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacaccccctaatacttacccccgcttattagctgatattggcgggacgaac
gcgcgctttggactagaaagagcccccggagagattaattcagttgaggtcctagcttgc
cacgatcaccatagcgtggtggatgcgatcaagtgttatttaaacaaagtgggtaatcca
tctgtcaaactggctgcctgtgccattgctaaccccgtcattggggattgggtgcagatg
actaaccaccattgggctttttcaattgaaaccacccgccaagctttggggtttgatacg
cttttattcatcaatgattttgccgcccaagcttatgcgatcgcacaattaaacgatgat
gaattgttgcaagtgggggggacagcctgcgcgctccatgcacctaagttagtcattggt
ccgggcacggggctaggggtgagcgcgctcattccctgccacaatgggcattacattgcc
ctatccggggagggcgggcatgtgagttttgcgccctttgatgatactgaaatcgccatt
tggaaatacgccaagaaaaaatacgggcatgtgtccgctgaaagacttttaagcggggcg
ggattggtgctcatccatgcggctttggctgaacgcgaggggatcaagactgctaaaatg
acccctgagatcatcagcgaacaagccttaagcggaaaatcgcccctatgccgcctgacc
ctagatattttttgcacgatcttgggcacggtgtcttctaacatggcgttggttttgggg
gcgcgtgggggggtgtatttatgcggggggatcatccctagatttattgattattttaaa
acttcgccctttagggtgcgttttgaaaataaagggcgttttgatgcctacttggcagcc
attccagtttatgttgtcttggctaaatatcccggtctagccggggttgccattgcctta
gaaaaccacctcaacaaagagtga

DBGET integrated database retrieval system