KEGG   Helicobacter bizzozeronii: HBZC1_13810Help
Entry
HBZC1_13810       CDS       T01540                                 

Definition
alternative dihydrofolate reductase 2 / dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1284092..1285231)
Genome map
AA seq 379 aa AA seqDB search
MFLERINPTSFPLALERIAPHPAGQKIMAKKAQLLAFKITALPLSATLILKQEALRVGAE
LATPKDCILARAKTYDCLLVGTLDQLQKLCQKCQTQDFGLKKLVKILQTHLHPTRPKPAL
MGVINLTPDSFYPHSRHNTKQALEKIQLYLEQGVEYIDIGAASSRPFSHRVEASEEIVRL
KEVCLEIKDQGFYTQARFSIDTYNPQSAAFALDHGFSVLNDVNGFREQEMLRIAQAHNAQ
VILMHSQGVPMDMARFDQNTHLIAGIETFFDTQIALLLEHGIEDIILDVGLGFHKNTPEN
LALIQHLEHFLHFGYPLLVGASYKKCIGEVCGREVEDRLSGTLALHFAALQHGASILRVH
DIAPHQDIIKIHQALAQVP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaacgcattaatcctacaagttttcccctagccctagagcgcatcgccccc
cacccagccgggcaaaaaatcatggcaaaaaaggcgcaacttttagcctttaagatcacg
gctcttcccttaagcgcaacactcattttaaaacaagaggcattgcgtgtgggtgccgag
cttgccacccccaaagattgcattttagcccgtgccaaaacctatgattgtttgctagtg
ggcactttggatcagctccaaaaattatgccaaaaatgccaaacccaagattttgggctt
aaaaaactagtcaagattttacaaacccacctacaccccacccgccccaaaccagccctt
atgggcgtgatcaatctcacccctgatagcttttacccccatagccgccacaacaccaag
caagccctagaaaaaatccagctgtatttagagcagggcgtagaatacattgacattggg
gcagctagctctagaccctttagccacagagtggaagccagcgaagagatcgtgcgttta
aaagaggtgtgtttagagatcaaagatcaagggttctacacacaagccagatttagcata
gacacctataacccccaaagtgccgcctttgccctagatcatggctttagcgtgctcaat
gatgtcaatggctttagggagcaagaaatgttgcgtatcgcccaagcccataacgcccaa
gtgatcttaatgcactctcaaggcgtgcccatggacatggcacgctttgatcaaaacacc
catctaatcgctgggatagaaactttttttgatacccaaattgcccttttgctagaacat
ggcatagaggatattatcttagatgtgggcttgggcttccataaaaacacccctgaaaat
ctcgccctcatccagcacttggagcattttttgcactttggctatcccctgttggtgggg
gctagctataaaaagtgcattggggaagtgtgtgggcgcgaggttgaagatcgcttgagt
ggcaccctagccctgcactttgctgccctccagcatggggctagtatcttgcgtgtgcat
gacatcgccccccaccaagacataatcaaaatccaccaagccctagcccaagtgccctaa

DBGET integrated database retrieval system