KEGG   Helicobacter bizzozeronii: HBZC1_14220Help
Entry
HBZC1_14220       CDS       T01540                                 

Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBZC1_14220
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBZC1_14220
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HBZC1_14220
Enzymes [BR:hbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HBZC1_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1316840..1317634)
Genome map
AA seq 264 aa AA seqDB search
MRYAPVFKALKTANKPAFVPFVTLGDPSYDLSFEIVKTLIDAGVSALELGFAFSDPIADG
PVIQEGNLRALRRANMAANFELLERVRKLAPSMPIGLLVYANLIMRFGMDRFYAACAKSG
VDSVLVADVPLRESAEFIKAAHQHAIAPVFLATPNASPEHLEHIAQNCPAYIYVLARAGV
TGTQEHLATTPQHILHTLKKISPTPCLLGFGISQPSHVQSALSMGADGVICGSAVVQIIA
QNLEHPPSMLARLREFVAQMVGES
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgcccccgtttttaaggctctcaaaacagccaataaacccgcttttgtgccc
tttgtcactttgggcgatcctagctatgatctgagctttgagattgtcaaaaccctcatc
gatgcgggtgtgagcgcgctggagttgggttttgccttttctgaccccatagctgatggg
ccggtgattcaagagggcaacttaagggcgttgcgtcgggcgaacatggcggctaatttt
gaactcttagagcgtgtgcgcaagcttgcacctagtatgccaatcggcttgttagtctat
gccaatttgatcatgcgctttggaatggatcgcttttatgctgcatgtgcaaaaagtggg
gtggatagcgtgctggttgcggatgtgcccttgcgtgagagtgcggaatttatcaaagca
gcccaccaacacgccatcgccccggtttttttagccacccccaatgccagcccagagcat
ttagagcacatcgctcaaaattgccctgcctatatttatgtccttgcccgtgcaggggta
acaggcacacaagaacacctagccaccaccccccagcacattctacacacgctcaaaaag
atcagccccaccccttgcttgctaggctttgggatttcacagccctcccatgtgcaaagt
gctttgagcatgggggctgatggggtgatctgtggttcggctgttgtgcagatcatcgcc
caaaatttggagcaccctcctagcatgctggcacgcttaagggagtttgtggcgcagatg
gtgggggagagttag

DBGET integrated database retrieval system