KEGG   Helicobacter bizzozeronii: HBZC1_14230Help
Entry
HBZC1_14230       CDS       T01540                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00260  Glycine, serine and threonine metabolism
hbi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
hbi01130  Biosynthesis of antibiotics
hbi01230  Biosynthesis of amino acids
Module
hbi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBZC1_14230
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HBZC1_14230
Enzymes [BR:hbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HBZC1_14230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Citrus_P18
Motif
Other DBs
NCBI-ProteinID: CCB80409
UniProt: F8KU70
Position
complement(1317631..1318815)
Genome map
AA seq 394 aa AA seqDB search
MVTQNKEAYFGAFGGLFVPEILIPPLAQLEEAFKACLHDLDFQAQFSDLLTHFLGRPTPL
TRVKNLISNPKVRLYLKREDLLHGGAHKSNQALGQALLAKKMGKKRIIAETGAGQHGVAT
ALACALLDLECVIYMGTKDIERQAPNVFRMELMGARVVPVSTGSASLKDAINEALRDWAN
SYPTTHYLLGTAAGPHPYPKMVKHFQSMIGSETRAQILEQEGCLPDVVIACVGGGSNAIG
MFSAFLEDSQVQLVGVEPAGLGLESGKHGAVLCRGSVGILHGSKTYILQDEQGQIIESHS
ISAGLDYPGVGPEHSYLKTSGRASYVGISDQEALEAFVALSKHEGIIPALESAHALAYAL
KLAKEDQKRVIVVNLSGRGDKDLQSVQEALKARS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggttacacaaaataaagaagcgtattttggtgcttttggcgggctctttgtgcccgaa
attttaatcccccccttagcccagctagaggaggcatttaaggcgtgcttgcatgatttg
gattttcaagcccagtttagtgatcttttaacccactttctaggtcgcccaacgcctcta
acacgggttaaaaacctcatttctaaccccaaagttaggctttatctcaaacgggaggat
ttattgcacgggggcgcgcacaagagcaaccaagccctagggcaagcccttttggctaag
aaaatgggtaaaaaacgcatcattgctgaaaccggagcagggcagcacggggtcgccact
gcccttgcttgtgcgcttttagatttagaatgcgtgatttatatgggcacaaaggatata
gaacgccaagcccccaatgtcttccgcatggaattaatgggcgcacgggtggtgccagtc
agcaccggctcagccagcctcaaagatgcgatcaatgaggcactaagggattgggcaaac
tcttatcctaccacgcattatctcttaggcacagccgctggcccacacccttaccccaaa
atggtcaagcatttccaaagcatgatcggatcagagactagagcgcaaatcttggagcag
gaggggtgtttgcctgatgtggtgattgcatgcgtgggtggggggagcaatgcgattggg
atgttttctgcttttttggaggatagccaagtgcagttagtgggggttgagcctgctggt
ttggggctagagagtggcaaacatggcgcggtgctgtgtcgtgggagcgtggggattttg
catgggagcaagacctatattttacaagatgaacaggggcagatcatagagagtcatagc
atttcagccgggctagattatccgggcgtgggtccggaacatagttatttaaagactagc
gggcgggctagttatgtgggcattagcgatcaagaggcattagaggcgtttgtggcttta
agcaaacatgagggcattatccccgctttggagagtgcgcatgccctagcctatgcgctc
aagctagccaaagaagatcaaaaacgcgtgatcgtggtgaatttgagcgggcggggggat
aaagatttgcaaagcgtgcaagaggcgttaaaggctagatcatga

DBGET integrated database retrieval system