KEGG   Helicobacter bizzozeronii: HBZC1_15560Help
Entry
HBZC1_15560       CDS       T01540                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hbi00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hbi00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hbi00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hbi00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1440671..1441759
Genome map
AA seq 362 aa AA seqDB search
MRRVFLTGCVYLCFLGGEEANNRLSPSQLAHKGYTTGPQYPDFYKPWFYGLKDSWSVPPR
KPKKVNILSDFAKKYLDIMEYRGTYFMPFYHSFTPIYQWYFPSINRYQSTEFKFQVSFRV
PVIRHFLFTTGTLYLAYTQTNWFQIYNNPQSAPMRMVNYMPELIYVYPLNIPFFTEKMGR
LSEFWIGWQHISNGIGGRQCYQPFKNGNPTDAFPGTPVHITEENKQIIVQQGGLDGGCRS
VSAGQRPVFKLTWQKGGLKIRVAYWPYIPYNQSNPNLIDFMGYGNAFIDYRRGRHHFEMR
IYDIFTQYWRYKRWHGAIRIGYTFRISRFVGLYMQYFNGYGDGLYEYDVFSNRFGVGIRL
NP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagggttttcctaacaggctgtgtttatctttgttttttagggggtgaggaggct
aataaccgcctaagcccctcgcaattagcccacaagggttatacaaccggtcctcagtac
ccagatttttacaagccatggttttatggcttaaaagactcttggagtgtgccccccaga
aagcccaaaaaagtcaatatcttaagcgactttgctaaaaaatacttggatattatggaa
taccgtgggacttactttatgcccttttaccatagctttacccccatttaccagtggtat
ttccccagcattaaccgctaccaaagcaccgaatttaaattccaagtgagttttagagtc
ccggttatccggcattttctcttcaccaccggcacactctatttagcctacacccaaacc
aactggttccaaatttataacaacccccaaagcgcgcccatgcgcatggtcaattacatg
cccgagctcatttatgtctatccgctcaatatcccctttttcaccgaaaagatggggcgt
ctgagtgagttttggattggttggcaacatatttctaatggcattgggggcaggcagtgc
taccagccttttaaaaatgggaatcccactgatgcctttccggggacacctgtgcatatc
acagaagagaataagcaaataattgtccagcaaggagggcttgatgggggttgtcgctca
gtgagtgccgggcagcgccccgtattcaaactcacatggcaaaagggggggctcaaaatt
agagtggcttactggccctatatcccttataaccaatccaacccgaatttgattgatttt
atgggttatgggaacgcttttattgactataggcgggggcggcatcattttgaaatgcgc
atttatgacattttcacgcaatattggcgctacaaacgctggcatggggcgattcgtatc
ggttataccttcagaatcagtcgctttgtcgggctttacatgcagtattttaatggctat
ggagatggactctacgaatacgatgtcttctctaaccgctttggggtcgggattcgcctc
aatccctag

DBGET integrated database retrieval system