KEGG   Helicobacter bizzozeronii: HBZC1_15610Help
Entry
HBZC1_15610       CDS       T01540                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hbi  Helicobacter bizzozeronii
Brite
Enzymes [BR:hbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HBZC1_15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 Methyltransf_32 Methyltransf_4 Methyltransf_12 NodS Methyltr_RsmB-F Ubie_methyltran PrmA DUF4159 DREV tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: CCB80547
UniProt: F8KP42
Position
1445428..1446060
Genome map
AA seq 210 aa AA seqDB search
MFQIKNAHMCEAIAQRFNLEESIKNAICAINREEFVPSKQLAYSLDALPMGADQFISSPL
TVAKMTQFLKPQGADSVLEIGCGSGYQAMVLSKLFRRVFSIERIEKLLVEAKKRFRKLGA
TNIHTKLGDGQLGWSEYGPYDRILFSACTHSIPPALSDQLEEGGILVAPILDNQAQKITR
FIKKGGVLVVDQVLDRCLFVPILDGIERGV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgttccaaattaagaacgcacacatgtgcgaggcgatcgcccaacgctttaacttagaa
gagtccattaaaaacgccatttgtgcgatcaatcgcgaggaatttgtcccctctaaacag
ctagcttatagcttggatgccttgccaatgggggccgatcagttcattagctcccctttg
accgtggctaagatgacccaatttttaaagcctcaaggggctgatagtgtcctagaaatt
gggtgtgggagcgggtatcaagccatggtgctctccaaactctttaggcgagtcttcagc
attgagcgcattgaaaaactcttggtggaggctaagaaacgctttagaaaactgggggcg
accaatatccacaccaagctaggagatgggcaacttggctggagcgagtatggcccctat
gatcgcattttattttctgcctgcacgcatagtatccccccagcactaagcgatcagctt
gaagaggggggtattctagtggctcctattttagataaccaagcccaaaagatcacccgt
tttattaaaaaaggcggggttttggtggtggatcaggtgctggatcgttgcttatttgtg
cccattttagatgggattgaacggggtgtttaa

DBGET integrated database retrieval system